Diaphorina citri psyllid: psy6709


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MKSLQSIIYEKHSLKILDQLLLPHTSKLVDINNVEDAYQAIKSMQVRGAPAIAIVGCLGLVVDIKDKQFPDNELIQLIESMLEKDISDNKAIGRNGAQALIDLNPRVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIVDIKDKQFPDNDSLEKYVGEKLDYLVSARPTAVNMKRAADSVKSSLSEWAKASPVNTVKTRLIQLIESMLEKDISDNKAIGRNGAQALIDLNPGVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIGAAYCTETRPYNQGAR
ccccEEEEEEccEEEEEccccccccEEEEEEccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccCEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccccccccccccccHHHHHHHHHHcccccEEEEccccccccccc
*KSLQSIIYEKHSLKILDQLLLPHTSKLVDINNVEDAYQAIKSMQVRGAPAIAIVGCLGLVVDIKDKQFPDNELIQLIESMLEKDISDNKAIGRNGAQALIDLNPRVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIVDIKDKQFPDNDSLEKYVGEKLDYLVSARPTAVNMKRAADSVKSSLSEWAKASPVNTVKTRLIQLIESMLEKDISDNKAIGRNGAQALIDLNPGVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIGAAYCTETRPYNQG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSLQSIIYEKHSLKILDQLLLPHTSKLVDINNVEDAYQAIKSMQVRGAPAIAIVGCLGLVVDIKDKQFPDNELIQLIESMLEKDISDNKAIGRNGAQALIDLNPRVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIVDIKDKQFPDNDSLEKYVGEKLDYLVSARPTAVNMKRAADSVKSSLSEWAKASPVNTVKTRLIQLIESMLEKDISDNKAIGRNGAQALIDLNPGVSKLNVLTHCNTGSLATAEYGTALGVIRSLHGANKIGAAYCTETRPYNQGAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ9V9X4
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ4WNI1
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ9CQT1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W2W, chain A
Confidence level:very confident
Coverage over the Query: 3-70,109-116,149-273
View the alignment between query and template
View the model in PyMOL
Template: 2A0U, chain A
Confidence level:very confident
Coverage over the Query: 2-69,147-288
View the alignment between query and template
View the model in PyMOL
Template: 1T9K, chain A
Confidence level:very confident
Coverage over the Query: 71-143,157-234
View the alignment between query and template
View the model in PyMOL