Diaphorina citri psyllid: psy6711


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MGIKPIKWNLQIAVSAKHHKVPFFIAAPWTSIDLDIPNGDAIVIEERPSQEMTHVAGIHVAASDCGSKGTFQSHSGSINKVEDLPEMSIVELEDVKIIQDDHTIHKMSARINIIFSDCDKFMTNYGKPPSIFFFA
ccccccHHHHHHHHHHHHccccEEEEccccccccccccccccEEEccccccccCEccEEECcccccccccEEcccccccccccccccccccccEEEEEcccCEEcccHHHHHHHHHHHHHHHccccccccccccc
****PIKWNLQIAVSAKHHKVPFFIAAPWTSIDLDIPNGDAIVIEERPSQEMTHVAGIHVAASDCGSKGTFQSHSGSINKVEDLPEMSIVELEDVKIIQDDHTIHKMSARINIIFSDCDKFMTNYGKPPSIFFFA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIKPIKWNLQIAVSAKHHKVPFFIAAPWTSIDLDIPNGDAIVIEERPSQEMTHVAGIHVAASDCGSKGTFQSHSGSINKVEDLPEMSIVELEDVKIIQDDHTIHKMSARINIIFSDCDKFMTNYGKPPSIFFFA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ2NL31
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ0VFN1
Methylthioribose-1-phosphate isomerase Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).confidentQ7PKS9

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A0U, chain A
Confidence level:very confident
Coverage over the Query: 2-95
View the alignment between query and template
View the model in PyMOL