Diaphorina citri psyllid: psy6733

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------

MVPQGPGGADTDVFCPTAKYCTATLAATLDKQTLPPCLTPHPVGTSRCQPHYPYPATCSIHHAGREGPKKFRDCTPFTFASVCSGISVYSLLIMVWMITIVCYRYLIVSSIVPGSTLGIPDTVMGLTFVAAGVSVPDALSSLAVVKEGYGDMAVSNAVGSNVFDILVCLGLPWFLQTAIIKPGSHVNVYSKGLTYSTISLFSTVVFLISATHMNGWKLDRRYGAILMMWYFVFLIVGSLYELNVFGYMNPPECPSLY

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEECcccHHHHHHHHHHcHHHHHHHHHcccccCEECccccHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc

**************C*TAKYCTATLAATLDKQTLPPCLTPHPVGTSRCQPHYPYPATCSIHHAGREGPKKFRDCTPFTFASVCSGISVYSLLIMVWMITIVCYRYLIVSSIVPGSTLGIPDTVMGLTFVAAGVSVPDALSSLAVVKEGYGDMAVSNAVGSNVFDILVCLGLPWFLQTAIIKPGSHVNVYSKGLTYSTISLFSTVVFLISATHMNGWKLDRRYGAILMMWYFVFLIVGSLYELNVFGYMNPPEC****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable sodium/potassium/calcium exchanger CG1090	May function in the removal and maintenance of calcium homeostasis. Transports one Ca(2+) and 1 K(+) in exchange for 4 Na(+).	confident	Q9VN12

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031224 [CC]	intrinsic to membrane	probable	GO:0005575, GO:0044425, GO:0016020
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055085 [BP]	transmembrane transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0006816 [BP]	calcium ion transport	probable	GO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V5U, chain A
Confidence level:very confident
Coverage over the Query: 94-239
View the alignment between query and template
View the model in PyMOL