Diaphorina citri psyllid: psy6769


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MITCSNPEPSYVFQLGLFILNFTLLIPCSKKNVELLVNFVLRVPPLSPSPVIDISDDDLVTISVRDLNRQLKMRGLSREDIIKMKQRRRTLKNRGYAASCRIKRIEQKDELETEKSQEYQDMELMEQDCNLMREELHAYSLKCEALIKFAAKHKIHIPIELATV
ccccccccccHHHHccHHHccccccccccccccHHHHccccccccccccccccccHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
********PSYVFQLGLFILNFTLLIPCSKKNVELLVNFVLRVPPLSPSPVIDISDDDLVTISVRDLNRQLKMRG*****II*************YAASCR**************************DCNLMREELHAYSLKCEALIKFAAKHKIHIPIE****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITCSNPEPSYVFQLGLFILNFTLLIPCSKKNVELLVNFVLRVPPLSPSPVIDISDDDLVTISVRDLNRQLKMRGLSREDIIKMKQRRRTLKNRGYAASCRIKRIEQxxxxxxxxxxxxxxxxxxxxxCNLMREELHAYSLKCEALIKFAAKHKIHIPIELATV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor MafG Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2 (By similarity). May be involved in signal transduction of extracellular H(+).confidentQ76MX4
Transcription factor MafG Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+).confidentO15525
Transcription factor MafG Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. May be involved in signal transduction of extracellular H(+).confidentQ90889

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0060322 [BP]head developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045647 [BP]negative regulation of erythrocyte differentiationprobableGO:0051093, GO:0050793, GO:0045646, GO:0045595, GO:0032844, GO:0050789, GO:0045596, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0050794, GO:0045637, GO:0048523
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0000981 [MF]sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048839 [BP]inner ear developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0001816 [BP]cytokine productionprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0030641 [BP]regulation of cellular pHprobableGO:0019725, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A5T, chain A
Confidence level:very confident
Coverage over the Query: 51-143
View the alignment between query and template
View the model in PyMOL
Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 20-147
View the alignment between query and template
View the model in PyMOL