Diaphorina citri psyllid: psy676


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MVRATRHNTNANKKSGPGTPGSGKKLAYETDPAILLRRQKQIDFGKNTVGYDRYCSMVKREDRTKDHPKTPPKELKYSRRAWDGLIKSWRSRLHFWDPPNENGEPNSLLLDEDDDISSLDSQSVDSLPCTPIQEWKRRVRAKRESLSEDEEEDCKPLQD
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccc
******************************DPAILLRRQKQIDFGKNTVGYDRYCSMVKREDRTKDHPKTPPKELKYSRRAWDGLIKSWRSRLHFWDPPNENG********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRATRHNTNANKKSGPGTPGSGKKLAYETDPAILLRRQKQIDFGKNTVGYDRYCSMVKREDRTKDHPKTPPKELKYSRRAWDGLIKSWRSRLHFWDPPNENGEPNSLLLDEDDDISSLDSQSVDSLPCTPxxxxxxxxxxxxxxxxxxxxxDCKPLQD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone RNA hairpin-binding protein RNA-binding protein involved in the histone pre-mRNA processing. Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end processing by stabilizing the complex between histone pre-mRNA and U7 small nuclear ribonucleoprotein (snRNP), via the histone downstream element (HDE). Plays an important role in targeting mature histone mRNA from the nucleus to the cytoplasm and to the translation machinery. Stabilizes mature histone mRNA and could be involved in cell-cycle regulation of histone gene expression. Involved in the mechanism by which growing oocytes accumulate histone proteins that support early embryogenesis. Binds to the 5' side of the stem-loop structure of histone pre-mRNAs.confidentQ14493
Histone RNA hairpin-binding protein RNA-binding protein involved in the histone pre-mRNA processing. Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end processing by stabilizing the complex between histone pre-mRNA and U7 small nuclear ribonucleoprotein (snRNP), via the histone downstream element (HDE). Plays an important role in targeting mature histone mRNA from the nucleus to the cytoplasm and to the translation machinery. Stabilizes mature histone mRNA and could be involved in cell-cycle regulation of histone gene expression (By similarity). Involved in the mechanism by which growing oocytes accumulate histone proteins that support early embryogenesis. Binds to the 5' side of the stem-loop structure of histone pre-mRNAs.confidentP97440
Histone RNA hairpin-binding protein Involved in histone pre-mRNA 3' processing and couples histone mRNA production with the cell cycle. Both maternal and zygotic proteins play an essential and vital function for development.confidentQ9VAN6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071204 [CC]histone pre-mRNA 3'end processing complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0051028 [BP]mRNA transportprobableGO:0015931, GO:0050658, GO:0051234, GO:0033036, GO:0050657, GO:0071705, GO:0008150, GO:0006810, GO:0071702, GO:0051236, GO:0006403, GO:0051179
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071207 [MF]histone pre-mRNA stem-loop bindingprobableGO:0036002, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006398 [BP]histone mRNA 3'-end processingprobableGO:0008334, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0035613 [MF]RNA stem-loop bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KJM, chain A
Confidence level:very confident
Coverage over the Query: 29-58
View the alignment between query and template
View the model in PyMOL
Template: 4HXH, chain C
Confidence level:probable
Coverage over the Query: 28-98
View the alignment between query and template
View the model in PyMOL