Diaphorina citri psyllid: psy6778


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MHFLKLLCVPLLIGAVCGEKIDLNSDPCYENGRPRRCIPDFVNAAFGQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVISRGNEQEALCTDRHKKQGGRCKCNGHASRCIKSPQGELVCECRHNTAGKDCEKCKPFFSDRPWGRATVYDANECKGGRCKCNGHASRCIKSPQGALVCECRHNTAGKDCEKCKPFFSDRPWGRATVYDANECK
cHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccCEEEEEEcccEEEEEEEEEEEcccccccccEEEEEcccccccCEEcEEcHHHHHHHccccccccccccccccEEEccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccCECcccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccc
MHFLKLLCVPLLIGAVCGEKIDLNSDPCYENGRPRRCIPDFVNAAFGQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVISRGNEQEALCTDRHKKQGGRCKCNGHASRCIKSPQGELVCECRHNTAGKDCEKCKPFFSDRPWGRATVYDANECKGGRCKCNGHASRCIKSPQGALVCECRHNTAGKDCEKCKPFFSDRPWGRATV****ECK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFLKLLCVPLLIGAVCGEKIDLNSDPCYENGRPRRCIPDFVNAAFGQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVISRGNEQEALCTDRHKKQGGRCKCNGHASRCIKSPQGELVCECRHNTAGKDCEKCKPFFSDRPWGRATVYDANECKGGRCKCNGHASRCIKSPQGALVCECRHNTAGKDCEKCKPFFSDRPWGRATVYDANECK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Netrin-B Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either fra or unc-5 receptors will lead to axon attraction or repulsion, respectively. While short-range repulsion requires both fra and unc-5 receptors, long-range repulsion only requires unc-5.confidentQ24568

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0040012 [BP]regulation of locomotionprobableGO:0008150, GO:0065007, GO:0050789
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0033564 [BP]anterior/posterior axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0040023 [BP]establishment of nucleus localizationprobableGO:0051234, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0048732 [BP]gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0060562 [BP]epithelial tube morphogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0030517 [BP]negative regulation of axon extensionprobableGO:0022604, GO:0048638, GO:0044707, GO:0045926, GO:0051239, GO:0030308, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0061387, GO:0031345, GO:0031344, GO:0044699, GO:0016043, GO:0050767, GO:0048869, GO:0040008, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010721, GO:0048640, GO:0048519, GO:0065008, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051093, GO:0048699, GO:0050771, GO:0050770, GO:0007399, GO:0048856, GO:0045595, GO:0051960, GO:2000026, GO:0032535, GO:0007275, GO:0008150, GO:0048523
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0045773 [BP]positive regulation of axon extensionprobableGO:0048639, GO:0048638, GO:0048856, GO:0045927, GO:0022603, GO:0030307, GO:0030154, GO:0051128, GO:0016043, GO:0061387, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0040008, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010720, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051239, GO:0044707, GO:0048699, GO:0050770, GO:0007399, GO:0050772, GO:0022604, GO:0051094, GO:0045595, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0032502, GO:0032535, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQT, chain A
Confidence level:very confident
Coverage over the Query: 27-302
View the alignment between query and template
View the model in PyMOL
Template: 3ZYG, chain A
Confidence level:confident
Coverage over the Query: 16-308
View the alignment between query and template
View the model in PyMOL