Diaphorina citri psyllid: psy678


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MQRAQSLLKCENAAKLLEVVHDLFEEQTSIEQVVVKIMQRAQSLLKCENAAVLLIDESSS
cHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHEEEEEEccccc
*******LKCENAAKLLEVVHDLFEEQTSIEQVVVKIMQRAQSLLKCENAAVLLIDE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRAQSLLKCENAAKLLEVVHDLFEEQTSIEQVVVKIMQRAQSLLKCENAAVLLIDESSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.confidentQ8VID6
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.confidentQ9HCR9
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.confidentP0C1Q2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0006198 [BP]cAMP catabolic processprobableGO:0009187, GO:0009214, GO:0046434, GO:0009166, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0009259, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0046483, GO:0046058, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0008152, GO:0034655, GO:0046700, GO:0009056, GO:0055086, GO:1901565, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0019693, GO:0006163, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0009987, GO:0006753, GO:0044281
GO:0004118 [MF]cGMP-stimulated cyclic-nucleotide phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0004114, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004112
GO:0046069 [BP]cGMP catabolic processprobableGO:0009187, GO:0009214, GO:0046434, GO:0009166, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0046068, GO:0072523, GO:0009259, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0046483, GO:0009987, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0008152, GO:0034655, GO:0046700, GO:0009056, GO:0055086, GO:1901565, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0019693, GO:0006163, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:0044281
GO:0030553 [MF]cGMP bindingprobableGO:0043168, GO:0030551, GO:0019001, GO:0097159, GO:0000166, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:0043167, GO:1901363, GO:1901265, GO:0005488
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BJC, chain A
Confidence level:very confident
Coverage over the Query: 20-39
View the alignment between query and template
View the model in PyMOL