Diaphorina citri psyllid: psy6796


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MVGPIHGTVEFLLWDEVWQGSMGLNCPGGLSSMGSKLAYSMGFALNCPVVEYVTPEKYAHWEKVVEYVTPEKYAHWEKVGNSMGFLYTASGPLVRSSYKAGEFFIGSVLRNRKAAAEAKTENA
cccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHccccEECccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
****IHGTVEFLLWDEVWQGSMGLNCPGGLSSMGSKLAYSMGFALNCPVVEYVTPEKYAHWEKVVEYVTPEKYAHWEKVGNSMGFLYTASGPLVRSSYKAGEFFIGSVLR*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGPIHGTVEFLLWDEVWQGSMGLNCPGGLSSMGSKLAYSMGFALNCPVVEYVTPEKYAHWEKVVEYVTPEKYAHWEKVGNSMGFLYTASGPLVRSSYKAGEFFIGSVLRNRKAAAEAKTENA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentO43766
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentQ7JQW6
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentQ2LYK1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted