Diaphorina citri psyllid: psy679

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSGNSFERPSTKDDSGELCQPKTELITDSPLGLHEEEEETSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHHHHHPNMEGMPVVTTPL
cccccHHHHHHHHccccccccccccccccccccccccCEEEECccccccccccccCEEEEccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccECcccc
******RAEVLESNFLSQIPAWLPGAD***********TSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYL************************************************************************************************M******SLFPPLFIS****************************QHEMLN**I*****************EQDVYARVNQ*L*HSPNNKYQWLDSPV***********************************************QLAE*******************PLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHH****************TTP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSGNSFERPSTKDDSGELCQPKTELITDSPLGLHEEEEETSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHHHHHPNMEGMPVVTTPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Early growth response protein 2 (Fragment) Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4.confidentP26635
Early growth response protein 1 (Fragment) Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.confidentO73694
E3 SUMO-protein ligase EGR2 (Fragment) E3 SUMO-protein ligase helping SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation down-regulates EGR2 own transcriptional activity.confidentP26633

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006611 [BP]protein export from nucleusprobableGO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 364-480
View the alignment between query and template
View the model in PyMOL
Template: 1EJ6, chain B
Confidence level:probable
Coverage over the Query: 371-395
View the alignment between query and template
View the model in PyMOL