Psyllid ID: psy679

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSGNSFERPSTKDDSGELCQPKTELITDSPLGLHEEEEETSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHHHHHPNMEGMPVVTTPL
cccccHHHHHHHHccccccccccccccccccccccccEEEEEEccccccccccccEEEEEcccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEcccc
ccccccHHHHHHHcHcccccccccccccccccccccccccccccccccccccccccccHHcHHcccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccEccccccccccccccccccccHEEEEEEccccccccccccccccccccccEEEEEccccccccccccccEEccccHHHEcEccccccccccccccccccccEcccccccccccccccccHcccccccHHHHHHHccccccccccHccHHHHHHHHHHHHHHcccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccEcccccccEccccccEEccccc
MVGEGLRAEVLESNflsqipawlpgadqisnsggdgkttsfvnlshpptrsipeylilvempklrvlkrpkgcscivdispylesltgtrgslsgnsferpstkddsgelcqpktelitdsplglheeeeetslsstismypgsnpshsdkisyrgiftttnsspshqpgaasspgnnwmltgtdkslfpplfissgvlgqsnnsnqgpysgsspshydersqQHEMLNINIecgalkqpsssysscsgeqDVYARVNQslmhspnnkyqwldspVEYSASIvqaqpgiipkqepvygntnlsgcgslvnlsdpnnpgssypvqlaeynpstskghEILSQVyqqsplplklvpvkprkypnrpsktpvherpyacpvencdrrfsrsdELTRHIrihtgqkpfqcricmrsfsrsdhltthirthtgekpfscdvcgrkfarsdeKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVhqqqqhhhhhhhhhpnmegmpvvttpl
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFvnlshpptrsiPEYLILVEMPKLRVLKRPKGCSCIVDISpylesltgtrgslsgnsferpstkddsgelcqpktelitdsplglhEEEEETSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQsplplklvpvkprkypnrpsktpvherpyacpvencdRRFSRSDELTRhirihtgqkpfqcrICMRSFSRSDHLTThirthtgekpfscdvCGRKFarsdekkrhakvhlkqrskKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHhhhhpnmegmpvvTTPL
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSGNSFERPSTKDDSGELCQPKTELITDSPLGLHeeeeeTSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSplplklvpvkpRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSqqqaqqqqqqnhvhqqqqhhhhhhhhhPNMEGMPVVTTPL
************SNFLSQIPAWLP*************************RSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESL*********************************************************************************************MLTGTDKSLFPPLFIS************************************I*********************************************************************************************************************************************YACPVENCDRRFS**DELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRK**********************************************************************
******RAEVLESNFLSQIPAWLPGAD***********TSFVNLSHPPTRSIPEYLILVEMPK*****RPKGCSCIVDISPYL********************************************************************************************************************************************QHEMLN********************EQDVYARVNQ*L*HSPNNKYQWLDSPV***********************************************QLAE*******************PLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHH****************TTP*
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSG**************LCQPKTELITDSPLG**************SMYPGSNPSHSDKISYRGIFTTT*************PGNNWMLTGTDKSLFPPLFISSGVLGQSNN******************QQHEMLNINIECGALK***********EQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKY**********ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFA*********************************************************MEGMPVVTTPL
*****LRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGC*C********************************************************************************************************M******SLFPPLFISSG*LGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHHHHHPNMEGMPV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEGLRAEVLESNFLSQIPAWLPGADQISNSGGDGKTTSFVNLSHPPTRSIPEYLILVEMPKLRVLKRPKGCSCIVDISPYLESLTGTRGSLSGNSFERPSTKDDSGELCQPKTELITDSPLGLHEEEEETSLSSTISMYPGSNPSHSDKISYRGIFTTTNSSPSHQPGAASSPGNNWMLTGTDKSLFPPLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGEQDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVHQQQQHHHHHHHHHPNMEGMPVVTTPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
P26632511 Early growth response pro no N/A 0.268 0.268 0.716 2e-57
P43300387 Early growth response pro yes N/A 0.227 0.299 0.836 3e-57
P43301387 Early growth response pro yes N/A 0.227 0.299 0.836 3e-57
A4II20498 Early growth response pro yes N/A 0.252 0.259 0.744 3e-57
P08046533 Early growth response pro no N/A 0.227 0.217 0.827 3e-57
Q06889387 Early growth response pro yes N/A 0.227 0.299 0.836 4e-57
Q6NTY6475 Early growth response pro N/A N/A 0.252 0.271 0.744 6e-57
P18146543 Early growth response pro no N/A 0.221 0.208 0.840 6e-57
P08154508 Early growth response pro no N/A 0.313 0.314 0.632 1e-56
Q6GQH4497 Early growth response pro N/A N/A 0.266 0.273 0.707 1e-56
>sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/141 (71%), Positives = 114/141 (80%), Gaps = 4/141 (2%)

Query: 331 STSKGHEILSQVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDE 390
           +T  G + L  VYQ       + P + RKYPNRPSKTP HERPYACPVE CDRRFSRSDE
Sbjct: 272 ATQTGSQDLKSVYQSQ----LIKPSRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDE 327

Query: 391 LTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRH 450
           LTRHIRIHTGQKPFQCRICMR+FSRSDHLTTHIRTHTGEKPF+C++CGRKFARSDE+KRH
Sbjct: 328 LTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRH 387

Query: 451 AKVHLKQRSKKESKMAVMMSQ 471
            K+H++Q+ KK  K A    Q
Sbjct: 388 TKIHMRQKDKKAEKGATAAVQ 408
Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Danio rerio (taxid: 7955)
>sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 Back     alignment and function description
>sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 Back     alignment and function description
>sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 Back     alignment and function description
>sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 Back     alignment and function description
>sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=1 SV=1 Back     alignment and function description
>sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 Back     alignment and function description
>sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 Back     alignment and function description
>sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 Back     alignment and function description
>sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
242010839472 Early growth response protein, putative 0.625 0.675 0.598 1e-100
328708213 688 PREDICTED: hypothetical protein LOC10015 0.652 0.484 0.568 3e-99
270002538 772 hypothetical protein TcasGA2_TC004846 [T 0.641 0.423 0.581 7e-98
189234146 845 PREDICTED: similar to conserved hypothet 0.641 0.386 0.581 2e-97
170048318 760 conserved hypothetical protein [Culex qu 0.615 0.413 0.570 1e-94
347968524 1108 AGAP002773-PB [Anopheles gambiae str. PE 0.588 0.270 0.556 8e-90
347968526 799 AGAP002773-PA [Anopheles gambiae str. PE 0.588 0.375 0.556 2e-89
198455353 1219 GA27565 [Drosophila pseudoobscura pseudo 0.617 0.258 0.494 6e-87
195570007 1019 GD19200 [Drosophila simulans] gi|1941989 0.615 0.308 0.506 9e-87
195107371 1171 GI23713 [Drosophila mojavensis] gi|19391 0.578 0.251 0.531 4e-86
>gi|242010839|ref|XP_002426166.1| Early growth response protein, putative [Pediculus humanus corporis] gi|212510213|gb|EEB13428.1| Early growth response protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  373 bits (958), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 219/366 (59%), Positives = 254/366 (69%), Gaps = 47/366 (12%)

Query: 131 ETSLSSTISMYPG-SNPSHSDKISYRGIFTTTNSSP-----SHQPGAASSPG----NNWM 180
           E S S++ +M+PG  + S   KISYRG+FTTT +SP        PG + SP     N+W+
Sbjct: 57  EDSCSNSSTMFPGHESQSQQGKISYRGVFTTTGASPLSISSGQLPGLSPSPTPGGINHWL 116

Query: 181 LTGTDKSLFPPLFISSGVLGQSNNSNQGPY----SGSSPSHYDERSQQ-HEMLNINIECG 235
           L   DK+LFPP+F   G+LGQ       P     +GS   HY++RSQQ HE+L + ++  
Sbjct: 117 LPSPDKTLFPPIF---GLLGQQQPGQSSPQQYHATGSPTGHYEDRSQQQHELLGLGLDNL 173

Query: 236 ALKQPSSSYSSCS-------------GEQDVYARVNQSLMHSPNNKYQWLDSP-VEYSAS 281
           ALKQP S YSSCS              +     RV+QSL      KY WLDS  V+Y + 
Sbjct: 174 ALKQPPS-YSSCSVPTSSGLPMNEVQPDLSYSTRVSQSL--GSGAKYHWLDSQNVDYGSQ 230

Query: 282 I-VQAQPGIIPKQEPVYGNTNLSGCGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILS 340
           + V    G++PK+EP    ++          S+     S + VQLAEYN STSKGHEILS
Sbjct: 231 LHVPGPSGVVPKEEPYTSTSS----------SEVVQGQSQFSVQLAEYNVSTSKGHEILS 280

Query: 341 QVYQQSPLPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTG 400
           QVYQQ+ +PLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTG
Sbjct: 281 QVYQQTHMPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTG 340

Query: 401 QKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSK 460
           QKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQR K
Sbjct: 341 QKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQR-K 399

Query: 461 KESKMA 466
           KESK+A
Sbjct: 400 KESKLA 405

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328708213|ref|XP_001943786.2| PREDICTED: hypothetical protein LOC100159519 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270002538|gb|EEZ98985.1| hypothetical protein TcasGA2_TC004846 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234146|ref|XP_970833.2| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170048318|ref|XP_001851900.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870416|gb|EDS33799.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347968524|ref|XP_003436239.1| AGAP002773-PB [Anopheles gambiae str. PEST] gi|333467965|gb|EGK96774.1| AGAP002773-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347968526|ref|XP_312150.5| AGAP002773-PA [Anopheles gambiae str. PEST] gi|333467964|gb|EAA44878.5| AGAP002773-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|198455353|ref|XP_002138058.1| GA27565 [Drosophila pseudoobscura pseudoobscura] gi|198133209|gb|EDY68616.1| GA27565 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195570007|ref|XP_002103000.1| GD19200 [Drosophila simulans] gi|194198927|gb|EDX12503.1| GD19200 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195107371|ref|XP_001998287.1| GI23713 [Drosophila mojavensis] gi|193914881|gb|EDW13748.1| GI23713 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
UNIPROTKB|Q26452512 sr "Sr protein" [Drosophila sp 0.517 0.515 0.560 3.7e-74
FB|FBgn00034991186 sr "stripe" [Drosophila melano 0.517 0.222 0.560 1.5e-73
RGD|2544508 Egr1 "early growth response 1" 0.221 0.222 0.849 4.8e-56
UNIPROTKB|G3V8I9536 Egr1 "Early growth response pr 0.221 0.210 0.849 4.8e-56
MGI|MGI:95295533 Egr1 "early growth response 1" 0.215 0.206 0.863 4.8e-56
UNIPROTKB|Q6GQH4497 egr1-a "Early growth response 0.539 0.553 0.439 1.4e-55
UNIPROTKB|Q6NTY6475 egr1-b "Early growth response 0.533 0.572 0.445 3.7e-55
UNIPROTKB|A4II20498 egr1 "Early growth response pr 0.527 0.540 0.452 3.4e-54
ZFIN|ZDB-GENE-040718-394422 zgc:92020 "zgc:92020" [Danio r 0.539 0.651 0.444 5.5e-54
ZFIN|ZDB-GENE-980526-320511 egr1 "early growth response 1" 0.543 0.542 0.426 1.5e-53
UNIPROTKB|Q26452 sr "Sr protein" [Drosophila sp. (taxid:7242)] Back     alignment and assigned GO terms
 Score = 697 (250.4 bits), Expect = 3.7e-74, Sum P(2) = 3.7e-74
 Identities = 157/280 (56%), Positives = 177/280 (63%)

Query:   191 PLFISSGVLGQSNNSNQGPYSGSSPSHYDERSQQHEMLNINIECGALKQPSSSYSSCSGE 250
             PL +       +  S   P  G   S ++++ QQ + +    +   L  P+  Y+    +
Sbjct:   181 PLLLKQPPPSYAGASAGFPGLGDLHSSHEQQLQQQQYVRSQPKYQWLDSPAD-YAQ---Q 236

Query:   251 QDVYARVNQSLMHSPNNKYQWLDSPVEYSASIVQAQPGI-IPKQE------PVYGNTNLS 303
             Q    +V Q        +   L  P   SAS   A  G+ IPKQE      P    T  S
Sbjct:   237 QQQVQQVQQQ---QQQQQTLVLPGPTS-SASSSNAALGVLIPKQENYPDMQPSSNGTGYS 292

Query:   304 G-CGSLVNLSDPNNPGSSYPVQLAEYNPSTSKGHEILSQVYQQSXXXXXXXXXXXRKYPN 362
             G  G     +      ++  VQLAEY+PSTSKGHEILSQVYQQS           RKYPN
Sbjct:   293 GGSGGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQSTVPLKLVPVKPRKYPN 352

Query:   363 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTH 422
             RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTH
Sbjct:   353 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTH 412

Query:   423 IRTHTGEKPFSCDVCGRKFARSDEKKRHAKVHLKQRSKKE 462
             IRTHTGEKPFSCD+CGRKFARSDEKKRHAKVHLKQR KKE
Sbjct:   413 IRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKE 452
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007390 "germ-band shortening" evidence=IMP
GO:0007398 "ectoderm development" evidence=IMP
GO:0007417 "central nervous system development" evidence=IMP
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IGI;IMP
GO:0007517 "muscle organ development" evidence=IMP
GO:0007525 "somatic muscle development" evidence=IMP
GO:0016204 "determination of muscle attachment site" evidence=TAS
GO:0042440 "pigment metabolic process" evidence=TAS
FB|FBgn0003499 sr "stripe" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2544 Egr1 "early growth response 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8I9 Egr1 "Early growth response protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:95295 Egr1 "early growth response 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GQH4 egr1-a "Early growth response protein 1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTY6 egr1-b "Early growth response protein 1-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A4II20 egr1 "Early growth response protein 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-394 zgc:92020 "zgc:92020" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-320 egr1 "early growth response 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O73694EGR1_SERCANo assigned EC number0.94910.11561.0N/AN/A
P26635EGR2_POERENo assigned EC number0.90160.11960.9838N/AN/A
P26633EGR2_CRIGR6, ., 3, ., 2, ., -0.91800.11960.9838noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-06
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-06
COG5189423 COG5189, SFP1, Putative transcriptional repressor 6e-04
PRK10019 279 PRK10019, PRK10019, nickel/cobalt efflux protein R 0.004
PRK10019 279 PRK10019, PRK10019, nickel/cobalt efflux protein R 0.004
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information 
 Score = 43.5 bits (103), Expect = 3e-06
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 418 HLTTHIRTHTGEKPFSCDVCGRKFAR 443
           +L  H+RTHTGEKP+ C VCG+ F+ 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26

Length = 26
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG2462|consensus279 99.77
KOG2462|consensus279 99.68
KOG3576|consensus267 99.53
KOG3623|consensus1007 99.46
KOG3576|consensus267 99.27
KOG3623|consensus 1007 99.21
KOG1074|consensus 958 99.01
KOG1074|consensus 958 98.94
PHA00733128 hypothetical protein 98.8
KOG3608|consensus 467 98.73
KOG3608|consensus467 98.71
PLN03086567 PRLI-interacting factor K; Provisional 98.62
PHA0276855 hypothetical protein; Provisional 98.51
PHA0276855 hypothetical protein; Provisional 98.34
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.15
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.1
PLN03086567 PRLI-interacting factor K; Provisional 98.07
PHA00733128 hypothetical protein 97.97
KOG3993|consensus500 97.92
COG5189423 SFP1 Putative transcriptional repressor regulating 97.87
PHA0073279 hypothetical protein 97.68
PHA0061644 hypothetical protein 97.64
KOG3993|consensus500 97.42
PHA0061644 hypothetical protein 97.33
PHA0073279 hypothetical protein 97.31
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.15
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.99
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.75
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.69
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.47
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.37
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.11
PRK04860160 hypothetical protein; Provisional 95.78
smart0035526 ZnF_C2H2 zinc finger. 95.66
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.32
COG5048467 FOG: Zn-finger [General function prediction only] 94.79
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.73
COG5048467 FOG: Zn-finger [General function prediction only] 94.3
PRK04860160 hypothetical protein; Provisional 94.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.94
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.99
KOG1146|consensus 1406 92.97
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.7
smart0035526 ZnF_C2H2 zinc finger. 92.45
KOG4173|consensus253 92.42
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 90.49
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 88.96
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 87.16
COG5189423 SFP1 Putative transcriptional repressor regulating 86.51
COG5236 493 Uncharacterized conserved protein, contains RING Z 86.45
KOG2186|consensus 276 86.37
KOG4124|consensus442 84.52
KOG2231|consensus 669 84.48
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 83.87
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.46
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 82.93
KOG2231|consensus 669 80.28
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 80.24
>KOG2462|consensus Back     alignment and domain information 
Probab=99.77  E-value=3.8e-19  Score=177.07  Aligned_cols=110  Identities=32%  Similarity=0.639  Sum_probs=100.6

Q ss_pred             CCCcccCCCCCCCccCChHHHHHHHHHhcCCCceecccCCCccCCchhhhhhhhcccCCCceecCcCCCccCChHHHHHH
Q psy679          371 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRH  450 (510)
Q Consensus       371 EKPy~C~~e~CgKsFssss~LkrH~rtHtgeKPfkC~~CgKsF~~ks~L~rH~rtHtGeKPfkC~~CgKaFsrsssLkrH  450 (510)
                      .+-|.|+  .|+|.|.+-..|+.|+|+|+  -+++|.+|||.|.+.--|..|+|+|||||||.|..|+|+|+.+++|+.|
T Consensus       159 ~ka~~C~--~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAH  234 (279)
T KOG2462|consen  159 KKAFSCK--YCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAH  234 (279)
T ss_pred             cccccCC--CCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHH
Confidence            5678895  59999999999999999997  5899999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcccchhHHHHHHHHHHHHHHHHHHHhhhh
Q psy679          451 AKVHLKQRSKKESKMAVMMSQQQAQQQQQQNHVH  484 (510)
Q Consensus       451 lRtHtgeK~~k~~~~~~~~~QQQ~qQQqQQN~~~  484 (510)
                      |++|.+.|.|+|..|.+.|+..--...+......
T Consensus       235 mQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~C~  268 (279)
T KOG2462|consen  235 MQTHSDVKKHQCPRCGKSFALKSYLNKHSESACL  268 (279)
T ss_pred             HHhhcCCccccCcchhhHHHHHHHHHHhhhhccc
Confidence            9999999999999999999988766666554433

>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG4124|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-45
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-45
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 6e-45
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-44
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-44
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-43
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-43
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-34
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-34
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-27
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-27
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-24
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-19
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-18
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-18
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-15
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-15
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-15
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-13
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-12
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-11
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-11
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 3e-10
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 6e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-10
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 5e-08
1xf7_A29 High Resolution Nmr Structure Of The Wilms' Tumor S 1e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-06
2ent_A48 Solution Structure Of The Second C2h2-Type Zinc Fin 3e-05
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 6e-05
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
1sp2_A31 Nmr Structure Of A Zinc Finger Domain From Transcri 2e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 4e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 4e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure 
Iteration: 1

 Score =  180 bits (456), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 79/88 (89%), Positives = 87/88 (98%)
Query: 371 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEK 430
           ERPYACPVE+CDRRFSRSDELTRHIRIHTGQKPFQCRICMR+FSRSDHLTTHIRTHTGEK
Sbjct: 2   ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEK 61
Query: 431 PFSCDVCGRKFARSDEKKRHAKVHLKQR 458
           PF+CD+CGRKFARSDE+KRH K+HL+Q+
Sbjct: 62  PFACDICGRKFARSDERKRHTKIHLRQK 89
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1XF7|A Chain A, High Resolution Nmr Structure Of The Wilms' Tumor Suppressor Protein (Wt1) Finger 3 Length = 29 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2ENT|A Chain A, Solution Structure Of The Second C2h2-Type Zinc Finger Domain From Human Krueppel-Like Factor 15 Length = 48 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1SP2|A Chain A, Nmr Structure Of A Zinc Finger Domain From Transcription Factor Sp1f2, Minimized Average Structure Length = 31 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-44
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-40
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-31
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-24
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-38
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-37
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-37
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-35
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-31
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-31
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-27
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-28
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-20
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-27
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-25
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-24
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-24
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-21
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-21
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-23
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-18
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-18
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-17
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-17
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-16
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-16
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-16
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-16
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-12
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-16
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-16
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-16
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-16
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-16
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-16
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-15
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-15
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-12
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-11
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-11
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-08
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-11
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 9e-11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 7e-07
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 1e-06
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 2e-05
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 4e-04
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 1e-06
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 2e-04
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 2e-06
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 2e-05
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 5e-05
1paa_A30 Yeast transcription factor ADR1; transcription reg 6e-05
1paa_A30 Yeast transcription factor ADR1; transcription reg 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 1e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 2e-04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 4e-04
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 4e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 8e-04
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
 Score =  150 bits (382), Expect = 1e-44
 Identities = 74/84 (88%), Positives = 81/84 (96%)

Query: 371 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEK 430
           ERPYACPVE+CDRRFS+S  LTRHIRIHTGQKPFQCRICMR+FSRSDHLTTHIRTHTGEK
Sbjct: 2   ERPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEK 61

Query: 431 PFSCDVCGRKFARSDEKKRHAKVH 454
           PF+CD+CGRKFARSDE+KRH K+H
Sbjct: 62  PFACDICGRKFARSDERKRHTKIH 85
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Length = 29 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Length = 29 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Length = 29 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Length = 33 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Length = 33 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Length = 33 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Length = 29 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.72
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.72
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.71
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.69
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.68
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.66
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.64
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.63
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.62
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.62
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.61
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.5
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.41
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.4
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.4
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.39
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.38
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.38
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.37
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.37
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.35
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.34
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.34
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.33
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.33
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.33
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.33
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.32
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.32
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.32
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.3
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.25
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.25
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.24
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.23
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.23
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.22
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.2
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.16
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.13
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.13
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.12
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.03
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.03
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.99
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.97
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.95
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.93
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.93
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.92
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.91
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.89
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.89
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.89
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.88
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.87
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.87
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.86
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.85
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.85
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.84
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.83
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.83
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.82
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.82
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.81
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.81
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.81
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.79
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.79
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.78
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.75
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.74
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.71
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.7
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.69
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.68
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.61
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.61
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.57
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.47
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.45
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.43
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.37
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.35
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.35
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.32
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.3
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.28
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.1
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.08
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.08
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.08
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.07
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.06
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.05
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.04
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.04
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.03
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.99
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.98
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.97
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.96
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.95
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.19
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.93
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.93
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.93
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.14
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.9
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.9
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.87
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.87
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.85
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.85
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.74
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.74
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.7
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.88
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.68
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.62
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.76
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.76
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.51
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.5
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.5
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.49
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.48
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.48
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.38
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.38
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.36
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.25
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.32
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.84
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.17
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.5
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.33
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.17
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.76
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 80.2
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.80  E-value=1.7e-20  Score=167.71  Aligned_cols=101  Identities=28%  Similarity=0.472  Sum_probs=92.2

Q ss_pred             CCCCCCCCCCcccCCCCCCCccCChHHHHHHHHHhcCCCceecccCCCccCCchhhhhhhhcccCCCceecCcCCCccCC
Q psy679          364 PSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFAR  443 (510)
Q Consensus       364 pskth~~EKPy~C~~e~CgKsFssss~LkrH~rtHtgeKPfkC~~CgKsF~~ks~L~rH~rtHtGeKPfkC~~CgKaFsr  443 (510)
                      ...++.|+++|.|.+  |++.|.....|.+|+++|+++++|.|..|++.|.....|..|+++|++++||.|+.|++.|.+
T Consensus        13 ~~~~h~Gek~y~C~~--C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~   90 (133)
T 2lt7_A           13 YELIVDGRVYYICIV--CKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFIN   90 (133)
T ss_dssp             EEEEETTEEEEEETT--TCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESS
T ss_pred             ceeecCCCcCeECCC--CCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhccccCCCccccCCCCCCCcCC
Confidence            345678999999954  999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhhcccc------hhHHHHH
Q psy679          444 SDEKKRHAKVHLKQRS------KKESKMA  466 (510)
Q Consensus       444 sssLkrHlRtHtgeK~------~k~~~~~  466 (510)
                      ...|..|+++|+++++      |+|..|.
T Consensus        91 ~~~L~~H~~~hh~~~p~~~~k~~~C~~C~  119 (133)
T 2lt7_A           91 YQFMSSHIKSVHSQDPSGDSKLYRLHPCR  119 (133)
T ss_dssp             HHHHHHHHHHHTCCCTTSSSCCEEECCCC
T ss_pred             HHHHHHHhHHhcCCCCCCCCCCeecCCCC
Confidence            9999999999988754      5665554
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 6e-14
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 9e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-13
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-13
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-12
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-12
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-11
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-11
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-11
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-10
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-10
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-09
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-10
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-09
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 6e-07
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 3e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-09
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 5e-09
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 5e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-08
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-08
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-07
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 5e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 5e-04
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 3e-04
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 2e-04
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 0.002
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 4e-04
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 0.003
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 0.003
d1bhia_38 g.37.1.1 (A:) Transactivation domain of cre-bp1/at 0.004
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: ZIF268
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 63.3 bits (154), Expect = 6e-14
 Identities = 22/28 (78%), Positives = 27/28 (96%)

Query: 429 EKPFSCDVCGRKFARSDEKKRHAKVHLK 456
           EKPF+CD+CGRKFARSDE+KRH K+HL+
Sbjct: 1   EKPFACDICGRKFARSDERKRHTKIHLR 28
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.38
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.96
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.96
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.95
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.85
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.84
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.84
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.78
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.75
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.73
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.68
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.66
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.64
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.62
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.61
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.56
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.54
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.5
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.49
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.45
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.41
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.41
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.41
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.36
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.33
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.28
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.24
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.18
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.03
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.98
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.31
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.15
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.13
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.06
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.93
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.92
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.92
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.79
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.7
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.65
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.62
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.61
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.56
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.49
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.35
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.05
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.04
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.01
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.94
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.93
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.93
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.68
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.27
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.2
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.95
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 94.9
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.75
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.72
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 94.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.32
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.25
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.02
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.93
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.82
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.76
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 92.1
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.91
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 91.33
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.12
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.49
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.06
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 89.29
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.74
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 88.63
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 88.5
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.56
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 84.57
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 83.77
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.79
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 82.64
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.47  E-value=5.9e-15  Score=110.79  Aligned_cols=53  Identities=34%  Similarity=0.822  Sum_probs=34.4

Q ss_pred             CCceecccCCCccCCchhhhhhhhcccCCCceecCcCCCccCChHHHHHHHHHh
Q psy679          401 QKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDVCGRKFARSDEKKRHAKVH  454 (510)
Q Consensus       401 eKPfkC~~CgKsF~~ks~L~rH~rtHtGeKPfkC~~CgKaFsrsssLkrHlRtH  454 (510)
                      ||+|+|. |++.|.....|..|+++|+|+|||.|.+||++|.+...|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4566663 6666666666666666666666666666666666666666666655
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure