Diaphorina citri psyllid: psy67

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520------

TLFGLRKVNEERRRVAWTDSGGVSETAFDGGKTNICRRAVSRTSGSLMRPLYGPVPAISMSRPRRSFRDSFRRRKDQHMPESSKPHQWQSDEASVRAGTCYFHVKVCLGKVKQGEEHSVFMRFGYRPSGDVLHLSASAFKYLGCVEVYESRGMQVCEDALKVVLIYMFALCYLGCVEVYESRGMQVCEDALKVLRYLGCVEVYESRGMQVCEDALKVLRNSRRRPVRAILYVSGDGLRVVDDETKGLMVDQTIEKVSFCAPDRNHEKGFSYICRDGTTRRWMCHGFLALKESGERLSHAVGCAFAACLERKQKRDKECGVTMNFDTTNSTFTRSGSFRQPTLTDRIIDGEVDMPVSPLSPPPNSVPTTPGSVKPPNPHAIERPHAPIPLLQRQGSFRGFSQLNQASPFKRQLSLRIGDLPSNLERTRLQQLSLTQANHANNIAPLIYLKTPVSPIPESISPLKSNGDPGERLSHAVGCAFAACLERKQKRDKECGVTMNFDTTNSTFTRSGSFRQPTLTDRIIDGE

ccccccccHHHHccEEEccccccccECcccccCEEEccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEccEEEcccccccccccccEEcccccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEcccccEEEEEEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEccCEEEECcccccEEEEEEccEEEEECcccccccEEEEEEEccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc

**FG***VNEERRRVAWTDSGGVSETAFDGGKTNICRRAV**********************************************************************************FG**PSGDVLHLSASAFKYLGCVEVYESRGMQVCEDALKVVLIYMFALCYLGCVEVYESRGMQVCEDALKVLRYLGCVEVYESRGMQVCEDALKVLRNSRRRPVRAILYVSGDGLRVVDDETKGLMVDQTIEKVSFCAPDRNHEKGFSYICRDGTTRRWMCHGFLALKESGERLSHAVGCAFAACLERKQK*DKECGVTMNFD****************************************************************************************************************************************************HAVGCAFAACLERK******CGVTMNF**************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein numb	Required in determination of cell fate during sensory organ formation in embryos. Functions in nuclei and seems to interact with nucleic acids.	confident	P16554

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045746 [BP]	negative regulation of Notch signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007405 [BP]	neuroblast proliferation	probable	GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0007275, GO:0032501, GO:0008150, GO:0061351, GO:0048731, GO:0022008, GO:0072089, GO:0044699
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0019897 [CC]	extrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0050767 [BP]	regulation of neurogenesis	probable	GO:0030154, GO:0007275, GO:0044699, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0007368 [BP]	determination of left/right symmetry	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0051130 [BP]	positive regulation of cellular component organization	probable	GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0035295 [BP]	tube development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0007417 [BP]	central nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F0W, chain A
Confidence level:very confident
Coverage over the Query: 197-314
View the alignment between query and template
View the model in PyMOL

Template: 1NTV, chain A
Confidence level:very confident
Coverage over the Query: 156-182,207-317
View the alignment between query and template
View the model in PyMOL

Template: 3F0W, chain A
Confidence level:very confident
Coverage over the Query: 81-105,141-165
View the alignment between query and template
View the model in PyMOL

Template: 2NMB, chain A
Confidence level:probable
Coverage over the Query: 194-316
View the alignment between query and template
View the model in PyMOL