Diaphorina citri psyllid: psy6804

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKHKQKPATIASKRMFDAAKVHYWSEMDKMNGVQNGSPHKRVDDVLEWHEYFMASAFLVAKRSKDPVTRVGAVIVNEDNKIVGTGYNGMPIGCSDDEFPWDKNTHDELDMCHAEMNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKQMSYK
ccEEEccccccccccEEEEcccccHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEccccccccccccccccccccccccEEEHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHccccEEEEccccccccc
MNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKHKQKPATIASKRMFDAAKVHYWSEMDKMNGVQNGSPHKRVDDVLEWHEYFMASAFLVAKRSKDPVTRVGAVIVNEDNKIVGTGYNGMPIGCSDDEFPWDKNTHDELDMCHAEMNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKHKQKPATIASKRMFDAAKVHYWSEMDKMNGVQNGSPHKRVDDVLEWHEYFMASAFLVAKRSKDPVTRVGAVIVNEDNKIVGTGYNGMPIGCSDDEFPWDKNTHDELDMCHAEMNAILNKNSADTKRCKLYTSLFPCNECAKVIIQSGIKEVIYMCDKQMSYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Deoxycytidylate deaminase Supplies the nucleotide substrate for thymidylate synthetase.confidentQ8K2D6
Deoxycytidylate deaminase Supplies the nucleotide substrate for thymidylate synthetase.confidentQ5RC69
Deoxycytidylate deaminase Supplies the nucleotide substrate for thymidylate synthetase.confidentP32321

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0004132 [MF]dCMP deaminase activityprobableGO:0016787, GO:0016810, GO:0016814, GO:0003824, GO:0019239, GO:0003674
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W4L, chain A
Confidence level:very confident
Coverage over the Query: 82-201
View the alignment between query and template
View the model in PyMOL
Template: 2W4L, chain A
Confidence level:very confident
Coverage over the Query: 1-70
View the alignment between query and template
View the model in PyMOL