Diaphorina citri psyllid: psy6806


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MSTSQKHQNFVSEPMGEKPVTELAGVGDVLGKRLESKGFDKAYVVLGQFLLLKQNEELFVDWMKETCQANAKQSGDCYNCLKDWCGEFL
ccccHHHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc
*******QNFVSEPMGEKPVTELAGVGDVLGKRLESKGFDKAYVVLGQFLLLKQNEELFVDWMKETCQANAKQSGDCYNCLKDWCGEFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSQKHQNFVSEPMGEKPVTELAGVGDVLGKRLESKGFDKAYVVLGQFLLLKQNEELFVDWMKETCQANAKQSGDCYNCLKDWCGEFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.very confidentO54962
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Functions are required in both M phase and interphase of the cell cycle.very confidentQ9VLU0
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.very confidentQ6P026

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005654 [CC]nucleoplasmconfidentGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0015074 [BP]DNA integrationconfidentGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005635 [CC]nuclear envelopeconfidentGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0050792 [BP]regulation of viral reproductionconfidentGO:0008150, GO:0043900, GO:0065007, GO:0050789, GO:0050794
GO:0030717 [BP]karyosome formationconfidentGO:0006996, GO:0044702, GO:0048610, GO:0051276, GO:0032504, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0048609, GO:0022412, GO:0008150, GO:0048477, GO:0007276, GO:0000003
GO:0075713 [BP]establishment of integrated proviral latencyconfidentGO:0044419, GO:0044703, GO:0000003, GO:0019042, GO:0019043, GO:0009987, GO:0019048, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0000779 [CC]condensed chromosome, centromeric regionconfidentGO:0005575, GO:0005622, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0009615 [BP]response to virusprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007059 [BP]chromosome segregationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006997 [BP]nucleus organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CI4, chain A
Confidence level:very confident
Coverage over the Query: 2-89
View the alignment between query and template
View the model in PyMOL