Diaphorina citri psyllid: psy6814


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
LKIKFSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGLSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYLILSLLFTMFVLKTFHAIPELKIMKILSLRFNDPGFYKNAS
cEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
LKIKFSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGLSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYLILSLLFTMFVLKTFHAIPELKIMKILSLRFNDP*******
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LKIKFSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGLSYLGSLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYLILSLLFTMFVLKTFHAIPELKIMKILSLRFNDPGFYKNAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium channel subfamily K member 1 Weakly inward rectifying potassium channel.confidentO00180
Potassium channel subfamily K member 1 Weakly inward rectifying potassium channel.confidentQ5UE96
Potassium channel subfamily K member 1 Weakly inward rectifying potassium channel.confidentQ5RD07

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005267 [MF]potassium channel activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0022857, GO:0015075, GO:0015077, GO:0015267, GO:0003674, GO:0022803, GO:0046873, GO:0022838, GO:0015079
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UKM, chain A
Confidence level:very confident
Coverage over the Query: 32-158
View the alignment between query and template
View the model in PyMOL
Template: 3OUF, chain A
Confidence level:very confident
Coverage over the Query: 8-64
View the alignment between query and template
View the model in PyMOL