Psyllid ID: psy6814
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| 47228939 | 132 | unnamed protein product [Tetraodon nigro | 0.491 | 0.636 | 0.535 | 7e-22 | |
| 321457297 | 369 | hypothetical protein DAPPUDRAFT_218276 [ | 0.614 | 0.284 | 0.467 | 7e-22 | |
| 357625402 | 363 | hypothetical protein KGM_17995 [Danaus p | 0.584 | 0.275 | 0.49 | 2e-21 | |
| 432905942 | 335 | PREDICTED: potassium channel subfamily K | 0.538 | 0.274 | 0.516 | 5e-21 | |
| 328702860 | 313 | PREDICTED: potassium channel subfamily K | 0.725 | 0.396 | 0.346 | 5e-21 | |
| 410901515 | 334 | PREDICTED: potassium channel subfamily K | 0.497 | 0.254 | 0.529 | 6e-21 | |
| 348507008 | 335 | PREDICTED: potassium channel subfamily K | 0.584 | 0.298 | 0.480 | 1e-20 | |
| 91077788 | 330 | PREDICTED: similar to TWiK family of pot | 0.345 | 0.178 | 0.597 | 1e-20 | |
| 270001497 | 365 | hypothetical protein TcasGA2_TC000334 [T | 0.345 | 0.161 | 0.597 | 1e-20 | |
| 339238251 | 330 | potassium channel subfamily K member 1 [ | 0.538 | 0.278 | 0.521 | 2e-20 |
| >gi|47228939|emb|CAG09454.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Score = 108 bits (270), Expect = 7e-22, Method: Compositional matrix adjust.
Identities = 45/84 (53%), Positives = 68/84 (80%)
Query: 72 LFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYL 131
LF+ IPA VFS++E NW++LDS YFCFIS++TIGLGDY+PGE+ Q+++ +YK+ ++VYL
Sbjct: 10 LFLLIPAAVFSALEDNWNFLDSFYFCFISLSTIGLGDYVPGEAANQKYREMYKMAITVYL 69
Query: 132 ILSLLFTMFVLKTFHAIPELKIMK 155
IL L+ + VL+TF + +LK ++
Sbjct: 70 ILGLIVMLVVLETFCELQQLKQLR 93
|
Source: Tetraodon nigroviridis Species: Tetraodon nigroviridis Genus: Tetraodon Family: Tetraodontidae Order: Tetraodontiformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|321457297|gb|EFX68386.1| hypothetical protein DAPPUDRAFT_218276 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|357625402|gb|EHJ75861.1| hypothetical protein KGM_17995 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|432905942|ref|XP_004077486.1| PREDICTED: potassium channel subfamily K member 1-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|328702860|ref|XP_001943901.2| PREDICTED: potassium channel subfamily K member 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|410901515|ref|XP_003964241.1| PREDICTED: potassium channel subfamily K member 1-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|348507008|ref|XP_003441049.1| PREDICTED: potassium channel subfamily K member 1-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|91077788|ref|XP_969244.1| PREDICTED: similar to TWiK family of potassium channels family member (twk-46) [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270001497|gb|EEZ97944.1| hypothetical protein TcasGA2_TC000334 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|339238251|ref|XP_003380680.1| potassium channel subfamily K member 1 [Trichinella spiralis] gi|316976404|gb|EFV59705.1| potassium channel subfamily K member 1 [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| UNIPROTKB|Q0P5A0 | 336 | KCNK1 "Potassium channel subfa | 0.502 | 0.255 | 0.494 | 6.4e-25 | |
| UNIPROTKB|F1RGV1 | 336 | KCNK1 "Uncharacterized protein | 0.502 | 0.255 | 0.494 | 6.4e-25 | |
| ZFIN|ZDB-GENE-070620-26 | 338 | kcnk1a "potassium channel, sub | 0.549 | 0.278 | 0.447 | 8.9e-25 | |
| UNIPROTKB|F1NP03 | 336 | KCNK1 "Uncharacterized protein | 0.497 | 0.252 | 0.488 | 1.2e-24 | |
| UNIPROTKB|O00180 | 336 | KCNK1 "Potassium channel subfa | 0.497 | 0.252 | 0.488 | 2.4e-24 | |
| MGI|MGI:109322 | 336 | Kcnk1 "potassium channel, subf | 0.497 | 0.252 | 0.488 | 2.4e-24 | |
| RGD|621447 | 336 | Kcnk1 "potassium channel, subf | 0.497 | 0.252 | 0.488 | 2.4e-24 | |
| WB|WBGene00006696 | 319 | twk-46 [Caenorhabditis elegans | 0.549 | 0.294 | 0.458 | 2e-21 | |
| ZFIN|ZDB-GENE-090312-78 | 337 | kcnk1b "potassium channel, sub | 0.684 | 0.347 | 0.389 | 8.2e-21 | |
| RGD|621450 | 313 | Kcnk6 "potassium channel, subf | 0.608 | 0.332 | 0.409 | 1.4e-18 |
| UNIPROTKB|Q0P5A0 KCNK1 "Potassium channel subfamily K member 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 217 (81.4 bits), Expect = 6.4e-25, Sum P(3) = 6.4e-25
Identities = 43/87 (49%), Positives = 58/87 (66%)
Query: 66 VITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKX 125
V+T+S F FIPA VFS +E +W++L+S YFCFIS++TIGLGDY+PGE Q+F+ LYK
Sbjct: 189 VVTVSCFF-FIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKI 247
Query: 126 XXXXXXXXXXXFTMFVLKTFHAIPELK 152
+ VL+TF + ELK
Sbjct: 248 GITCYLLLGLIAMLVVLETFCELHELK 274
|
|
| UNIPROTKB|F1RGV1 KCNK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070620-26 kcnk1a "potassium channel, subfamily K, member 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NP03 KCNK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00180 KCNK1 "Potassium channel subfamily K member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109322 Kcnk1 "potassium channel, subfamily K, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621447 Kcnk1 "potassium channel, subfamily K, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006696 twk-46 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090312-78 kcnk1b "potassium channel, subfamily K, member 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|621450 Kcnk6 "potassium channel, subfamily K, member 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 8e-06 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 1e-05 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Score = 41.4 bits (98), Expect = 8e-06
Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 7/80 (8%)
Query: 66 VITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKI 125
++ L +L Y W +LD+LYF F+++TTIG GD +P ++
Sbjct: 1 ILLLLVLIFGTVYYSLEEEGWGWDFLDALYFSFVTLTTIGYGDIVPLT-------DAGRL 53
Query: 126 IVSVYLILSLLFTMFVLKTF 145
+Y+++ + + L
Sbjct: 54 FTIIYILIGIPLFLLFLAVL 73
|
This family includes the two membrane helix type ion channels found in bacteria. Length = 74 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| KOG4404|consensus | 350 | 99.97 | ||
| KOG1418|consensus | 433 | 99.82 | ||
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.52 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.19 | |
| KOG4404|consensus | 350 | 99.16 | ||
| KOG1418|consensus | 433 | 99.07 | ||
| KOG3713|consensus | 477 | 99.06 | ||
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 98.87 | |
| KOG1419|consensus | 654 | 98.84 | ||
| KOG1545|consensus | 507 | 98.64 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.61 | |
| KOG1420|consensus | 1103 | 98.19 | ||
| KOG3713|consensus | 477 | 98.02 | ||
| KOG0498|consensus | 727 | 97.95 | ||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 97.87 | |
| KOG1545|consensus | 507 | 97.85 | ||
| KOG3193|consensus | 1087 | 97.81 | ||
| KOG4390|consensus | 632 | 97.76 | ||
| KOG3684|consensus | 489 | 97.66 | ||
| KOG1419|consensus | 654 | 97.52 | ||
| KOG0501|consensus | 971 | 97.38 | ||
| KOG4390|consensus | 632 | 97.3 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 96.9 | |
| KOG1420|consensus | 1103 | 96.31 | ||
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 96.05 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 95.72 | |
| KOG0501|consensus | 971 | 94.99 | ||
| KOG3193|consensus | 1087 | 94.83 | ||
| KOG3684|consensus | 489 | 92.42 | ||
| KOG3827|consensus | 400 | 92.17 | ||
| KOG0500|consensus | 536 | 87.26 | ||
| KOG0498|consensus | 727 | 86.3 | ||
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 82.25 |
| >KOG4404|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.1e-31 Score=220.28 Aligned_cols=141 Identities=35% Similarity=0.690 Sum_probs=118.8
Q ss_pred hhHHHHHHHHHHHHHHHhhhhccccC---------------------------------------------CCCCCccCc
Q psy6814 5 FSYLGSLVITLSILFIFIPAYVFSSI---------------------------------------------EPNWSYLDS 39 (171)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------------------------------~~~w~~~~a 39 (171)
=+++..+++.+.+.|+++||.+|..- ..+|+|.+|
T Consensus 5 qnvR~l~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~Ga 84 (350)
T KOG4404|consen 5 QNVRTLLLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGA 84 (350)
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcc
Confidence 36777888889999999999999643 149999999
Q ss_pred eeeeeeeEeccccCCCCcc-------------------c----------------------cccc---------h---hh
Q psy6814 40 LYFCFISITTIGLGDYIPG-------------------L----------------------SYLG---------S---LV 66 (171)
Q Consensus 40 ~yF~~~~lTTiGyGd~~Pg-------------------l----------------------~~~g---------~---l~ 66 (171)
|||+.|++||||||+.+|+ | ++.| | +.
T Consensus 85 FYFa~TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvmFqs~gERlnt~~ayil~~~r~~~~~r~~~~S~~~l~~i~ 164 (350)
T KOG4404|consen 85 FYFATTVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVMFQSIGERLNTFVAYILRRCRRRLGRRRWDVSVYNLVLIL 164 (350)
T ss_pred eEEEEEEEeeeccCCCCCCCcCceehhhhHHHhcCchHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCcHHHHHHHH
Confidence 9999999999999999993 0 1111 1 23
Q ss_pred hhHHHHHHhhhhhhhcccCCccccccceeEEEEEEecccccccccCCCC-CcccccchhhhhhHHHHHHHHHHHHHHHHH
Q psy6814 67 ITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESP-QQEFKSLYKIIVSVYLILSLLFTMFVLKTF 145 (171)
Q Consensus 67 ~~llli~i~iga~if~~~e~~ws~~da~Yf~~iT~tTIGfGD~~P~~~~-~~~~~~~~~~~~~~~i~~Gl~~~~~~~~~i 145 (171)
.....+.++.|+.+|+..| +|+|+||+||||||+|||||||+|+.++. ....+|.|+.+..+||++|+++++.++|.+
T Consensus 165 ~~~~~~~i~~gaa~fs~~E-~Wsyfds~YyCFITltTIGFGDyValQ~~~alq~qplYv~~sf~fIL~Gl~vi~a~~Nll 243 (350)
T KOG4404|consen 165 FTACILLICCGAAMFSSVE-GWSYFDSYYYCFITLTTIGFGDYVALQQDAALQSQPLYVFFSFVFILLGLCVIYALLNLL 243 (350)
T ss_pred HHHHHHHHHhhHHHhhccc-CcchhhhhheeeeeeeeccccchhhhcchhhhhCCCceehHhHHHHHHHHHHHHHHHHHH
Confidence 3344677789999999999 99999999999999999999999999873 335678999999999999999999999976
Q ss_pred H
Q psy6814 146 H 146 (171)
Q Consensus 146 ~ 146 (171)
+
T Consensus 244 v 244 (350)
T KOG4404|consen 244 V 244 (350)
T ss_pred H
Confidence 6
|
|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >KOG1545|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1545|consensus | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG3827|consensus | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 171 | ||||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 4e-17 | ||
| 3um7_A | 309 | Crystal Structure Of The Human Two Pore Domain K+ I | 1e-07 |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
|
| >pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 7e-18 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 2e-12 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 2e-08 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 2e-08 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 3e-07 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 6e-07 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 8e-06 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 2e-05 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 5e-05 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 3e-05 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 4e-05 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 6e-05 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 2e-04 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 4e-04 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 5e-04 |
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
Score = 77.6 bits (190), Expect = 7e-18
Identities = 50/147 (34%), Positives = 79/147 (53%)
Query: 11 LVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGLSYLGSLVITLS 70
I S++ I +++ + + G + + + L
Sbjct: 123 FCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTV 182
Query: 71 ILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVY 130
F FIPA VFS +E +W++L+S YFCFIS++TIGLGDY+PGE Q+F+ LYKI ++ Y
Sbjct: 183 SCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCY 242
Query: 131 LILSLLFTMFVLKTFHAIPELKIMKIL 157
L+L L+ + VL+TF + ELK + +
Sbjct: 243 LLLGLIAMLVVLETFCELHELKKFRKM 269
|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.97 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.95 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.67 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.64 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.63 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.62 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.61 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.59 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.58 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.55 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.54 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.51 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.43 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.33 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.27 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.22 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.17 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.14 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.13 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.1 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.09 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.05 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.04 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.04 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.0 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 98.95 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 98.95 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 98.93 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 98.83 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.82 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.77 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 98.76 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 98.61 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 98.47 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 98.44 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 98.36 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 98.34 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.32 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.23 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.04 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 97.89 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 97.71 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.67 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 97.45 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 97.37 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 96.01 |
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=4.2e-33 Score=230.41 Aligned_cols=134 Identities=43% Similarity=0.812 Sum_probs=109.7
Q ss_pred CCCCccCceeeeeeeEeccccCCCCcc----------------------c--------------------cccch-----
Q psy6814 32 PNWSYLDSLYFCFISITTIGLGDYIPG----------------------L--------------------SYLGS----- 64 (171)
Q Consensus 32 ~~w~~~~a~yF~~~~lTTiGyGd~~Pg----------------------l--------------------~~~g~----- 64 (171)
++|+|.||+||+++|+|||||||++|. + ++++.
T Consensus 90 ~~w~~~~a~yf~~~t~tTvGyGd~~P~T~~Gk~f~~~~~l~Gi~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~ 169 (280)
T 3ukm_A 90 WNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVV 169 (280)
T ss_dssp CCSSHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSTTTTTC------CCHHH
T ss_pred CCCChhcchhheeeeeeccccCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCChhHH
Confidence 579999999999999999999999992 0 11220
Q ss_pred -------hhhhHHHHHHhhhhhhhcccCCccccccceeEEEEEEecccccccccCCCCCcccccchhhhhhHHHHHHHHH
Q psy6814 65 -------LVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYLILSLLF 137 (171)
Q Consensus 65 -------l~~~llli~i~iga~if~~~e~~ws~~da~Yf~~iT~tTIGfGD~~P~~~~~~~~~~~~~~~~~~~i~~Gl~~ 137 (171)
+.+.++++++++++.+++..|++|++.||+|||++|+|||||||++|.+++++++.+.||+++++|+++|+++
T Consensus 170 ~~~~~~~l~~~~~~~~~~~ga~~~~~~E~~~s~~da~y~~~iTltTvGyGD~~p~t~~~~~~~~l~r~~~~~~il~Gl~~ 249 (280)
T 3ukm_A 170 AIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIA 249 (280)
T ss_dssp HHHHHHHHHHHHHHHHTHHHHHHHHHHSSSCCHHHHHHHHHHHHTTCCCCSCCSSCSSSCTTHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHhHHHHHHHHHhcCCchhhhhhheeeeeecccCCCCCCCCCcccccchhHHHHHHHHHHHHHHH
Confidence 2234456777899999999887899999999999999999999999999999888888999999999999999
Q ss_pred HHHHHHHHHHhhHHH-HHHHHhhccCCcC
Q psy6814 138 TMFVLKTFHAIPELK-IMKILSLRFNDPG 165 (171)
Q Consensus 138 ~~~~~~~i~~~~~~~-~~~~~~~~~~~~~ 165 (171)
+++.++.+.++.+.+ +++.++++|+.++
T Consensus 250 ~~~~~~~i~~~~~~~~l~~~~~~~~~~~~ 278 (280)
T 3ukm_A 250 MLVVLETFCELHELKKFRKMFYVKKDKDE 278 (280)
T ss_dssp HHHHHHHHHTSHHHHHHHHTTC-------
T ss_pred HHHHHHHHHHHHHHHHHHHHHhhhhhhhc
Confidence 999999999987777 8888887775554
|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 171 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 5e-05 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-04 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 37.8 bits (88), Expect = 5e-05
Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
Query: 10 SLVITLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGLSYLGSLVITL 69
+ ++ L + I F IE S+ SLY+ F++I T+G GDY P +TL
Sbjct: 3 TRILLLVLAVIIYGTAGFHFIE-GESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTL 61
Query: 70 SILFIFIPAYVFSSI 84
+L I A +
Sbjct: 62 IVLGIGTFAVAVERL 76
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.62 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.53 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.2 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.17 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.01 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 98.84 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 98.7 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 98.6 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 96.74 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 96.27 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Probab=99.62 E-value=1.6e-18 Score=116.46 Aligned_cols=73 Identities=25% Similarity=0.387 Sum_probs=65.2
Q ss_pred hHHHHHHhhhhhhhcccCCccccccceeEEEEEEecccccccccCCCCCcccccchhhhhhHHHHHHHHHHHHHHHHHHH
Q psy6814 68 TLSILFIFIPAYVFSSIEPNWSYLDSLYFCFISITTIGLGDYIPGESPQQEFKSLYKIIVSVYLILSLLFTMFVLKTFHA 147 (171)
Q Consensus 68 ~llli~i~iga~if~~~e~~ws~~da~Yf~~iT~tTIGfGD~~P~~~~~~~~~~~~~~~~~~~i~~Gl~~~~~~~~~i~~ 147 (171)
..+..++..++..++..| +|++.||+||+++|+|||||||++|.++.+ |++++++++.|+..++..++.+.+
T Consensus 7 ~~~~~~~~~g~~~~~~~e-~~s~~dalyf~~~T~tTiGyGD~~P~t~~~-------r~~~~~~~l~g~~~~~~~i~~i~~ 78 (80)
T d1lnqa2 7 LLVLAVIIYGTAGFHFIE-GESWTVSLYWTFVTIATVGYGDYSPSTPLG-------MYFTVTLIVLGIGTFAVAVERLLE 78 (80)
T ss_dssp TTTTTSHHHHTTTTTTSS-SCCSSTTHHHHHHHHTTCCCSSCCCCCSSH-------HHHHTHHHHTTSTTTTTHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHh-CCCHHHHHHHHhhheeeccCCCCCCCCcch-------HHHHHHHHHHHHHHHHHHHHHHHH
Confidence 344566778899999888 899999999999999999999999999876 999999999999999999988776
Q ss_pred h
Q psy6814 148 I 148 (171)
Q Consensus 148 ~ 148 (171)
.
T Consensus 79 ~ 79 (80)
T d1lnqa2 79 F 79 (80)
T ss_dssp T
T ss_pred h
Confidence 4
|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|