Diaphorina citri psyllid: psy6828


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MSLPVNLGLGLNSILRQSTVVKLVDNHKLFDWFCSWFQNVHTSQVSLSSNPDSDFRYSAIFTPIGIYKGRIFAIKRIPKKSVDITRAMKKELKIDIMENEDVKLDNMFIASLVADILRGMLYLHDSALRYHGNLKASNCLVDSRWVVKLADFGLTEFKRDAEYTGTDQHSFLQHTYHVNRAGSTESLHCKCDEALLFEMLPRSVAEQLRRGTSVEAESFDSVTIYFSDIVGFTAMSAESTPLQVVDFLNDLYTCFDSIVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAGEIASMSLDLLEAVKRFTVRHRPHDDLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEDVVA
ccccCEEHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEccccccccccccCCccCEEECccEEEEEEEccccEEEEHHcHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccEEEcccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHcccHHHHHHHHccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEECcccEEECcccccccccccccccccEEEEEECccEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccccccccccccccccHHHHHcccccccccccc
***PVNLGLGLNSILRQSTVVKLVDNHKLFDWFCSWFQNVHTSQVSL*****SDFRYSAIFTPIGIYKGRIFAIKRIPKKSVDITRAMKKELKIDIMENEDVKLDNMFIASLVADILRGMLYLHDSALRYHGNLKASNCLVDSRWVVKLADFGLTEFKRDAEYTGTDQHSFLQHTYHVNRAGSTESLHCKCDEALLFEMLPRSVAEQLRRGTSVEAESFDSVTIYFSDIVGFTAMSAESTPLQVVDFLNDLYTCFDSIVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAGEIASMSLDLLEAVKRFTVRHRPHDDLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASR**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPVNLGLGLNSILRQSTVVKLVDNHKLFDWFCSWFQNVHTSQVSLSSNPDSDFRYSAIFTPIGIYKGRIFAIKRIPKKSVDITRAMKKELKIDIMENEDVKLDNMFIASLVADILRGMLYLHDSALRYHGNLKASNCLVDSRWVVKLADFGLTEFKRDAEYTGTDQHSFLQHTYHVNRAGSTESLHCKCDEALLFEMLPRSVAEQLRRGTSVEAESFDSVTIYFSDIVGFTAMSAESTPLQVVDFLNDLYTCFDSIVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAVGNYDVYKVETIGDAYMVVSGLPIRNGEQHAGEIASMSLDLLEAVKRFTVRHRPHDDLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEDVVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Atrial natriuretic peptide receptor 2 Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.confidentP16067
Atrial natriuretic peptide receptor 2 Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.confidentQ6VVW5
Atrial natriuretic peptide receptor 2 Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.confidentP20594

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 212-283,316-391
View the alignment between query and template
View the model in PyMOL
Template: 3PLS, chain A
Confidence level:very confident
Coverage over the Query: 46-177
View the alignment between query and template
View the model in PyMOL
Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 45-200
View the alignment between query and template
View the model in PyMOL
Template: 3ET6, chain B
Confidence level:confident
Coverage over the Query: 213-263,294-388
View the alignment between query and template
View the model in PyMOL
Template: 4G31, chain A
Confidence level:confident
Coverage over the Query: 12-40
View the alignment between query and template
View the model in PyMOL