Diaphorina citri psyllid: psy6834

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---

MLPQIFFHNIPITDTEEIDSIFTLMTQKSLARYCTQNAAQITEANLKSVLQREFPKAKSIEVQDVSGGCGAMFEIMVISPEFKGLSTVKQHMLVNKDSSSNHSPYSRNFHQTTVAYSRNFHQTTVAYSRNFLQLCNSKELNFRNFQQTTVAYSSRICYDLHLQDGSLESSTCLLQWAGPKSLARYCTQNAAQITEANLKSVLQREFPKAKSIEVQDVSGGCGAMFEIMVISPEFKGLSTVKQHMLVNKVSLSGISYKCNRHWKSRILTSALKAVVHDHDRPKTNKQYDLRPSKMALKAEIKEMHGLRIHTDIE

ccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccHHcccccHHHHccccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccHHHccccccccHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccEEcccccHHHHHHccccccccccccccccccHHHHHHHHHHHcccEEEcccc

***QIFFHNIPITDTEEIDSIFTLMTQKSLARYCTQNAAQITEANLKSVLQREFPKAKSIEVQDVSGGCGAMFEIMVISPEFKGLSTVKQHMLVNKDSSSNHSPYSRNFHQTTVAYSRNFHQTTVAYSRNFLQLCNSKELNFRNFQQTTVAYSSRICYDLHLQDGSLESSTCLLQWAGPKSLARYCTQNAAQITEANLKSVLQREFPKAKSIEVQDVSGGCGAMFEIMVISPEFKGLSTVKQHMLVNKVSLSGISYKCNRHWKSRILTSALKAVVH****************************GLRIHT***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BolA-like protein DDB_G0274439		confident	Q86HT3

Prediction of Gene Ontology Terms

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O2E, chain A
Confidence level:very confident
Coverage over the Query: 40-118
View the alignment between query and template
View the model in PyMOL

Template: 3O2E, chain A
Confidence level:very confident
Coverage over the Query: 194-251
View the alignment between query and template
View the model in PyMOL

Template: 2KZ0, chain A
Confidence level:very confident
Coverage over the Query: 190-248,295-312
View the alignment between query and template
View the model in PyMOL