Diaphorina citri psyllid: psy6842


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MSGAISLQQTYMEAKFQVFFSGLKRLRSPYFDYQKSFELHGANEQSKGIMTDLKLNDMADDADTDGHRPVVSGHNRLYHHTITCLPVLPKEMDQDSDDQKDPKWLQTKTKMMIDEFTDVNEGEKELMKLWNLHVMKYGWGREKELMKLWNLHVMKYGYIVWLGDFKQGGYQPKIPLKKKQTLSVKGIHS
cccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccccccccccccccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccccc
********QTYMEAKFQVFFSGLKRLRSPYFDYQKS*********************************VVSGHNRLYHHTITCLPVL************DPKWLQTKTKMMIDEFTDVNEGEKELMKLWNLHVMKYGWGREKELMKLWNLHVMKYGYIVWLGDFKQGGYQPKIPLKKKQTLS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGAISLQQTYMEAKFQVFFSGLKRLRSPYFDYQKSFELHGANEQSKGIMTDLKLNDMADDADTDGHRPVVSGHNRLYHHTITCLPVLPKEMDQDSDDQKDPKWLQTKTKMMIDEFTDVNEGEKELMKLWNLHVMKYGWGREKELMKLWNLHVMKYGYIVWLGDFKQGGYQPKIPLKKKQTLSVKGIHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polycomb protein Suz12 Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems (By similarity). Genes repressed by the PRC2/EED-EZH2 complex include HOXA7, HOXB6 and HOXC8.confidentQ80U70
Polycomb protein suz12 Polycomb group (PcG) protein. Component of the prc2/eed-ezh2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene.confidentQ0VA03
Polycomb protein Su(z)12 Polycomb group (PcG) protein. While PcG proteins are generally required to maintain the transcriptionally repressive state of homeotic genes throughout development, this protein is specifically required during the first 6 hours of embryogenesis to establish the repressed state. Component of the Esc/E(z) complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The Esc/E(z) complex is necessary but not sufficient for the repression of homeotic target genes, suggesting that the recruitment of the distinct PRC1 complex is also required.confidentQ9NJG9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035064 [MF]methylated histone residue bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016571 [BP]histone methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0001739 [CC]sex chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0000803, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0005720, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0035098 [CC]ESC/E(Z) complexprobableGO:0031974, GO:0043229, GO:0035097, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031519, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0031491 [MF]nucleosome bindingprobableGO:0003682, GO:0003674, GO:0005488
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042054 [MF]histone methyltransferase activityprobableGO:0003824, GO:0016741, GO:0016740, GO:0008276, GO:0003674, GO:0008168

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted