Diaphorina citri psyllid: psy6845


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MPSKKQQYNLVQQDEYDTRIPMHSEEAFQHGITFQAKTRQKNKKEEKKKKEEEKKKREKMVHVPSTN
ccccccccccccccccccccccccHHHHHHccEEEEHHHHHHHHHHHHHHHHHHHHHHEEEEccccc
******Q*NLVQQDEYDTRIPMHSEEAFQHGITFQAKTR****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSKKQQYNLVQQDEYDTRIPMHSEEAFQHGITxxxxxxxxxxxxxxxxxxxxxxxxxxxxHVPSTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dystrophin-like protein 1 Together with dys-1 and hlh-1, participates in a common muscular function.confidentQ8STF6
Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4.confidentQ9D3A8
Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4.confidentO54960

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0008150 [BP]biological_processprobable
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F0W, chain A
Confidence level:probable
Coverage over the Query: 7-43
View the alignment between query and template
View the model in PyMOL