Diaphorina citri psyllid: psy6853


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MPWHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENREDLTGTQASKEVIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQEEMKLLESDTDEAFRNSDWADNTSLRKNLLGLNRISWKPR
ccHHHHHHHHHcHHHEECccccccccccHHcccccccccccccccccccccccEEEEccccccccccHHccccccccEEEEEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccccc
**WHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENRE**********VIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKI*************EEKKQLMLHYYRKQEE**********AFRNSDWA***SLRKNLLGLN*ISWKP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPWHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENREDLTGTQASKEVIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQEEMKLLESDTDEAFRNSDWADNTSLRKNLLGLNRISWKPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized protein C21orf59 homolog confidentQ6DRC3
Uncharacterized protein C21orf59 confidentP57076
Uncharacterized protein C21orf59 homolog confidentQ9VZH1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FBJ, chain B
Confidence level:probable
Coverage over the Query: 19-78
View the alignment between query and template
View the model in PyMOL