Diaphorina citri psyllid: psy6853

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----

MPWHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENREDLTGTQASKEVIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQEEMKLLESDTDEAFRNSDWADNTSLRKNLLGLNRISWKPR

ccHHHHHHHHHcHHHEECccccccccccHHcccccccccccccccccccccccEEEEccccccccccHHccccccccEEEEEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccccc

**WHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENRE**********VIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKI*************EEKKQLMLHYYRKQEE**********AFRNSDWA***SLRKNLLGLN*ISWKP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPWHHTLSLLRGCIMIVYPMNLPTHDPIRLEFENREDLTGTQASKEVIEPSMGALWFAGKAMHRDKFVRDFLGKNEKCKAIVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQEEMKLLESDTDEAFRNSDWADNTSLRKNLLGLNRISWKPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Uncharacterized protein C21orf59 homolog		confident	Q6DRC3
Uncharacterized protein C21orf59		confident	P57076
Uncharacterized protein C21orf59 homolog		confident	Q9VZH1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FBJ, chain B
Confidence level:probable
Coverage over the Query: 19-78
View the alignment between query and template
View the model in PyMOL