Diaphorina citri psyllid: psy6873


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MDVAQLRDLKNEVDIDEHLIPLEELYSILDTHPDRGLSELEVKRRLEKDGPNSLPQKYRINNVYILVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTVLVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTGSLLSVQQKYSPRTPWDLLNAGVRYIPSRYPKSGAYP
ccHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHEHHHHHHHHHHHHHccccccEEEEccCEEECccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccc
****Q*R*LKNEVDIDEHLIPLEELYSILDTHPDRGLSELEVKRRLEKDGPNSLPQKYRINNVYILVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTVLVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTGSLLSVQQKYSPRTPWDLLNAGVRYIPSRY*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVAQLRDLKNEVDIDEHLIPLEELYSILDTHPDRGLSELEVKRRLEKDGPNSLPQKYRINNVYILVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTVLVGYIFRGFSALLWFGALLSFLAYLLEAETNEEKPQDNLWLGIILALTCIVTGSLLSVQQKYSPRTPWDLLNAGVRYIPSRYPKSGAYP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005890 [CC]sodium:potassium-exchanging ATPase complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IXZ, chain A
Confidence level:very confident
Coverage over the Query: 15-157,169-204
View the alignment between query and template
View the model in PyMOL