Diaphorina citri psyllid: psy6874


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MKLILKERSSTSQENPNMWLGGAMEALKAIAFVCDIITYPVYLFLQRPWEKKSLSSKKKAEIISKDNKSVTIRSISGPQENHIRLIRDGVDTMEKVLRYVVTRFSDQRCLGTRQILAEEDEKQPNGRIFKKYVMGDYEWRSFNQVNDEAEAFGKGLRSLGQEPRHNVVIFAETRAEWMIAAQACFKQNIPVVTIYATLGEEAIAHGINETEVNIVITTHDLLPKFRNILKLTPRVSTLIYMEDQLTSTDTTNFKQGIEIVPFKQIVKRGSESGSRYEGSPPTPKDTAIIMYTSGSTGTPKGVVLTHDNMISTLKAFSDAVHIEPNDVFLGYLPLAHVFELLSESVCLLCGVAIGYSTPLTMIDTSSKIKRGTKGDASVLHPTALTAVPLILDRIYKGVHEKVSRASPFKRALFAFAFEYKRKWAKRGFRCPLIDKVVFGQTKKLLGGRVRLILSGGAPLSPDTHELIKVCLCEKVIQGYGLTETTSCATVMHLNDMGNINSNGL
cHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccCEEEEccccccccccccccEEcEEccccEEECHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccEEEEccccHHHHHHHHcccccccEEEEEccccccccccccccccEEEEHHHHHHHcccccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHccEEEECccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEECcccHHccccccccccccccccccccc
*****************MWLGGAMEALKAIAFVCDIITYPVYLFLQRPW************************SISGPQENHIRLIRDGVDTMEKVLRYVVTRFSDQRCLGTRQILAEEDEKQPNGRIFKKYVMGDYEWRSFNQVNDEAEAFGKGLRSLGQEPRHNVVIFAETRAEWMIAAQACFKQNIPVVTIYATLGEEAIAHGINETEVNIVITTHDLLPKFRNILKLTPRVSTLIYMEDQLTSTDTTNFKQGIEIVPFKQIVKRGSE********PPTPKDTAIIMYTSGSTGTPKGVVLTHDNMISTLKAFSDAVHIEPNDVFLGYLPLAHVFELLSESVCLLCGVAIGYSTPLTMIDTSSKIKRGTKGDASVLHPTALTAVPLILDRIYKGVHEKVSRASPFKRALFAFAFEYKRKWAKRGFRCPLIDKVVFGQTKKLLGGRVRLILSGGAPLSPDTHELIKVCLCEKVIQGYGLTETTSCATVMHLNDMGNINSNGL
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLILKERSSTSQENPNMWLGGAMEALKAIAFVCDIITYPVYLFLQRPWEKKSLSSKKKAEIISKDNKSVTIRSISGPQENHIRLIRDGVDTMEKVLRYVVTRFSDQRCLGTRQILAEEDEKQPNGRIFKKYVMGDYEWRSFNQVNDEAEAFGKGLRSLGQEPRHNVVIFAETRAEWMIAAQACFKQNIPVVTIYATLGEEAIAHGINETEVNIVITTHDLLPKFRNILKLTPRVSTLIYMEDQLTSTDTTNFKQGIEIVPFKQIVKRGSESGSRYEGSPPTPKDTAIIMYTSGSTGTPKGVVLTHDNMISTLKAFSDAVHIEPNDVFLGYLPLAHVFELLSESVCLLCGVAIGYSTPLTMIDTSSKIKRGTKGDASVLHPTALTAVPLILDRIYKGVHEKVSRASPFKRALFAFAFEYKRKWAKRGFRCPLIDKVVFGQTKKLLGGRVRLILSGGAPLSPDTHELIKVCLCEKVIQGYGLTETTSCATVMHLNDMGNINSNGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long-chain-fatty-acid--CoA ligase 3 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 has mainly an anabolic role in energy metabolism (By similarity). Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins) (By similarity). Mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates.confidentQ5R668
Long-chain-fatty-acid--CoA ligase 3 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 has mainly an anabolic role in energy metabolism (By similarity). Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins) (By similarity). Mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates.confidentQ9CZW4
Long-chain-fatty-acid--CoA ligase 3 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates (By similarity). Has mainly an anabolic role in energy metabolism. Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins).confidentO95573

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051049 [BP]regulation of transportprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0010890 [BP]positive regulation of sequestering of triglycerideprobableGO:0008150, GO:0010884, GO:0010883, GO:0048518, GO:0065007, GO:0032879, GO:0050789, GO:0010889
GO:0035282 [BP]segmentationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0004467 [MF]long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0044539 [BP]long-chain fatty acid importprobableGO:0051234, GO:0015718, GO:0015908, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0015909, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0008610 [BP]lipid biosynthetic processprobableGO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031966 [CC]mitochondrial membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0031967, GO:0031975, GO:0044446, GO:0005740, GO:0005739, GO:0044429, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1S, chain A
Confidence level:very confident
Coverage over the Query: 88-113,135-398,432-503
View the alignment between query and template
View the model in PyMOL
Template: 1RY2, chain A
Confidence level:very confident
Coverage over the Query: 90-114,132-401,433-503
View the alignment between query and template
View the model in PyMOL
Template: 2D1T, chain A
Confidence level:probable
Coverage over the Query: 141-270,284-390,410-416,428-495
View the alignment between query and template
View the model in PyMOL