Diaphorina citri psyllid: psy6883


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MEDSGRLYLGFHHSPHLLPQPHHTGPRTSFDSPLDLRGAPHPGDMYLRGAPHPGDMCNLSSPSPSSEDDSDADINVESDDGDEQGMKSDDGDEQGMSNVRRNIAEFHKHFSNCESDVNGCPTDGSISPGPEGDSDKQDGKNSIVKPPYSYIALITMAILQSPHKKLTLSGICEFIMSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRRRKRYKRTPPDFLLRDPHAAAMASFLGSDPYHHGLLPHSLQHGGFSFMSPLPPAVPLLPPSELARIQLGLNLLSNQSLPCKPVPLTSSSSRNTHIQKDKCSAVFSIDSLIGKNEFEKSAEKLDSDSEHSISKDKCSAVFSIDSLIGKNEFEKSAEKLDSDSEHSISVNRSPDSASYST
ccccccEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHccccccccEEccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccc
****GRL*LGFHH**********************************************************************************************************************************VKPPYSYIALITMAILQSPHKKLTLSGICEFIMSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRR*********************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDSGRLYLGFHHSPHLLPQPHHTGPRTSFDSPLDLRGAPHPGDMYLRGAPHPGDMCNLSSPSPSSEDDSDADINVESDDGDEQGMKSDDGDEQGMSNVRRNIAEFHKHFSNCESDVNGCPTDGSISPGPEGDSDKQDGKNSIVKPPYSYIALITMAILQSPHKKLTLSGICEFIMSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRRRKRYKRTPPDFLLRDPHAAAMASFLGSDPYHHGLLPHSLQHGGFSFMSPLPPAVPLLPPSELARIQLGLNLLSNQSLPCKPVPLTSSSSRNTHIQKDKCSAVFSIDSLIGKNEFEKSAEKLDSDSEHSISKDKCSAVFSIDSLIGKNEFEKSAEKLDSDSEHSISVNRSPDSASYST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Forkhead box protein D3 (Fragment) Binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. Also acts as a transcriptional activator. Promotes development of neural crest cells from neural tube progenitors. Restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. Required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis.confidentQ63245
Forkhead box protein D1 (Fragment) Transcription factor required for formation of positional identity in the developing retina, regionalization of the optic chiasm and morphogenesis of the kidney. Can neuralize ectodermal cells directly.confidentQ63251
Forkhead box protein D3 Binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. Also acts as a transcriptional activator. Promotes development of neural crest cells from neural tube progenitors. Restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. Required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis.confidentP79772

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingconfidentGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0001227 [MF]RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0001658 [BP]branching involved in ureteric bud morphogenesisprobableGO:0048754, GO:0001763, GO:0060675, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0072001, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0001655, GO:0001657, GO:0035295, GO:0044707, GO:0048856, GO:0048731
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0072268 [BP]pattern specification involved in metanephros developmentprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0061004, GO:0048856, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0001656, GO:0048731, GO:0072001, GO:0007275, GO:0044699, GO:0072048
GO:0048584 [BP]positive regulation of response to stimulusprobableGO:0048518, GO:0065007, GO:0048583, GO:0050789, GO:0008150
GO:0050935 [BP]iridophore differentiationprobableGO:0032502, GO:0043473, GO:0009987, GO:0048869, GO:0050931, GO:0030154, GO:0048066, GO:0044763, GO:0008150, GO:0044699
GO:0001755 [BP]neural crest cell migrationprobableGO:0030154, GO:0048468, GO:0006928, GO:0051674, GO:0001667, GO:0007275, GO:0044699, GO:0014032, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0016477, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0008150
GO:0048485 [BP]sympathetic nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048483, GO:0048731, GO:0007275, GO:0044699
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0030318 [BP]melanocyte differentiationprobableGO:0032502, GO:0043473, GO:0060429, GO:0048856, GO:0048869, GO:0050931, GO:0030154, GO:0009888, GO:0048066, GO:0044763, GO:0030855, GO:0060563, GO:0008150, GO:0009987, GO:0044699, GO:0002065
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0051240 [BP]positive regulation of multicellular organismal processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051216 [BP]cartilage developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0001829 [BP]trophectodermal cell differentiationprobableGO:0032502, GO:0032501, GO:0001824, GO:0044707, GO:0009987, GO:0048869, GO:0001825, GO:0030154, GO:0044767, GO:0009790, GO:0001701, GO:0044763, GO:0048646, GO:0009792, GO:0008150, GO:0043009, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0051090 [BP]regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0008301 [MF]DNA binding, bendingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048937 [BP]lateral line nerve glial cell developmentprobableGO:0021782, GO:0030154, GO:0048895, GO:0032501, GO:0010001, GO:0007275, GO:0044699, GO:0048869, GO:0048925, GO:0032502, GO:0048892, GO:0048468, GO:0048880, GO:0009987, GO:0042063, GO:0044767, GO:0008150, GO:0021545, GO:0021675, GO:0022008, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0048731
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048484 [BP]enteric nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048483, GO:0048731, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001892 [BP]embryonic placenta developmentprobableGO:0032502, GO:0001701, GO:0044707, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0044699, GO:0009792, GO:0048731, GO:0043009, GO:0007275, GO:0001890
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048846 [BP]axon extension involved in axon guidanceprobableGO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HFH, chain A
Confidence level:very confident
Coverage over the Query: 143-233
View the alignment between query and template
View the model in PyMOL