Diaphorina citri psyllid: psy6924


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
cccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEccccccccccHHHHHHHHHHccccEEEEEEEEEc
***TGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQIN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NHL repeat-containing protein 2 confidentQ8BZW8
NHL repeat-containing protein 2 confidentQ8NBF2
NHL repeat-containing protein 2 confidentQ5ZI67

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0009534 [CC]chloroplast thylakoidprobableGO:0009579, GO:0005737, GO:0031984, GO:0005575, GO:0043231, GO:0044464, GO:0031976, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0009536, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HYX, chain A
Confidence level:very confident
Coverage over the Query: 13-84
View the alignment between query and template
View the model in PyMOL