Psyllid ID: psy6924


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
cccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEccccccccccHHHHHHHHHHccccEEEEEEEEEc
ccccccccccccccccEcccccccccccEEccccccHHHHHccccEEEEEEEEEHHHHHHccccccHHHHHHHHHccccEEEEEEEEcc
mnytghcsfvpvplvaifhgrdfctkqewmntteplslnshlknkIVIMDFFTYCCincmhilpiPILIRHILEYKRTHIIKTFQINFK
mnytghcsfvpVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMhilpipilirhilEYKRTHIIKTFQINFK
***TGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQIN**
********************RDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQI***
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
**YTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYTGHCSFVPVPLVAIFHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTFQINFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query89 2.2.26 [Sep-21-2011]
Q8BZW8 725 NHL repeat-containing pro yes N/A 0.483 0.059 0.581 4e-11
Q8NBF2 726 NHL repeat-containing pro yes N/A 0.483 0.059 0.581 9e-11
A4IF69 726 NHL repeat-containing pro yes N/A 0.483 0.059 0.581 9e-11
Q5ZI67 727 NHL repeat-containing pro yes N/A 0.415 0.050 0.594 4e-10
>sp|Q8BZW8|NHLC2_MOUSE NHL repeat-containing protein 2 OS=Mus musculus GN=Nhlrc2 PE=2 SV=1 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 33/43 (76%)

Query: 22 DFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILP 64
          +F    EW+NT EPLS+   L  K+V++DFFTYCCINC+H+LP
Sbjct: 56 EFPEGLEWLNTEEPLSIYKDLCGKVVVLDFFTYCCINCIHVLP 98





Mus musculus (taxid: 10090)
>sp|Q8NBF2|NHLC2_HUMAN NHL repeat-containing protein 2 OS=Homo sapiens GN=NHLRC2 PE=1 SV=1 Back     alignment and function description
>sp|A4IF69|NHLC2_BOVIN NHL repeat-containing protein 2 OS=Bos taurus GN=NHLRC2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZI67|NHLC2_CHICK NHL repeat-containing protein 2 OS=Gallus gallus GN=NHLRC2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
91076402 712 PREDICTED: similar to CG12547 CG12547-PA 0.494 0.061 0.659 6e-13
432922359 720 PREDICTED: NHL repeat-containing protein 0.483 0.059 0.697 4e-12
317419409 719 NHL repeat-containing protein 2 [Dicentr 0.483 0.059 0.697 4e-12
170066897 734 NHL repeat containing 2 [Culex quinquefa 0.494 0.059 0.681 4e-12
157112324 812 hypothetical protein AaeL_AAEL000965 [Ae 0.494 0.054 0.659 1e-11
348508723 719 PREDICTED: NHL repeat-containing protein 0.483 0.059 0.674 1e-11
380016202 1439 PREDICTED: membrane-associated protein H 0.483 0.029 0.697 4e-11
345482264 768 PREDICTED: NHL repeat-containing protein 0.483 0.055 0.651 4e-11
390369862 322 PREDICTED: NHL repeat-containing protein 0.460 0.127 0.658 5e-11
410896258 716 PREDICTED: NHL repeat-containing protein 0.483 0.060 0.651 8e-11
>gi|91076402|ref|XP_969236.1| PREDICTED: similar to CG12547 CG12547-PA [Tribolium castaneum] gi|270002449|gb|EEZ98896.1| hypothetical protein TcasGA2_TC004511 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/44 (65%), Positives = 36/44 (81%)

Query: 21 RDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILP 64
          +DF +  EW N +EPLS + HLK KIV++DFFTYCCINCMHI+P
Sbjct: 44 KDFASGLEWFNVSEPLSFSKHLKGKIVVLDFFTYCCINCMHIIP 87




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|432922359|ref|XP_004080313.1| PREDICTED: NHL repeat-containing protein 2-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|317419409|emb|CBN81446.1| NHL repeat-containing protein 2 [Dicentrarchus labrax] Back     alignment and taxonomy information
>gi|170066897|ref|XP_001868267.1| NHL repeat containing 2 [Culex quinquefasciatus] gi|167863075|gb|EDS26458.1| NHL repeat containing 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157112324|ref|XP_001657496.1| hypothetical protein AaeL_AAEL000965 [Aedes aegypti] gi|108883769|gb|EAT47994.1| AAEL000965-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|348508723|ref|XP_003441903.1| PREDICTED: NHL repeat-containing protein 2-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|380016202|ref|XP_003692077.1| PREDICTED: membrane-associated protein Hem-like [Apis florea] Back     alignment and taxonomy information
>gi|345482264|ref|XP_001607897.2| PREDICTED: NHL repeat-containing protein 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|390369862|ref|XP_798415.2| PREDICTED: NHL repeat-containing protein 2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|410896258|ref|XP_003961616.1| PREDICTED: NHL repeat-containing protein 2-like [Takifugu rubripes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
MGI|MGI:1914116 725 Nhlrc2 "NHL repeat containing 0.370 0.045 0.636 9.7e-08
TAIR|locus:2010728 1055 AT1G56500 [Arabidopsis thalian 0.426 0.036 0.564 4.2e-07
MGI|MGI:1914116 Nhlrc2 "NHL repeat containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 9.7e-08, P = 9.7e-08
 Identities = 21/33 (63%), Positives = 27/33 (81%)

Query:    28 EWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCM 60
             EW+NT EPLS+   L  K+V++DFFTYCCINC+
Sbjct:    62 EWLNTEEPLSIYKDLCGKVVVLDFFTYCCINCI 94




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BZW8NHLC2_MOUSENo assigned EC number0.58130.48310.0593yesN/A
Q8NBF2NHLC2_HUMANNo assigned EC number0.58130.48310.0592yesN/A
Q5ZI67NHLC2_CHICKNo assigned EC number0.59450.41570.0508yesN/A
A4IF69NHLC2_BOVINNo assigned EC number0.58130.48310.0592yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 1e-17
cd03012126 cd03012, TlpA_like_DipZ_like, TlpA-like family, Di 4e-17
cd02966116 cd02966, TlpA_like_family, TlpA-like family; compo 4e-05
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score = 75.3 bits (185), Expect = 1e-17
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)

Query: 22  DFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILP 64
           +F  K +W+NT  PL     LK K+VI+DF+TYCCINCMH+LP
Sbjct: 399 EFPPKLDWLNTA-PLQFRRDLKGKVVILDFWTYCCINCMHVLP 440


Length = 1057

>gnl|CDD|239310 cd03012, TlpA_like_DipZ_like, TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 89
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.71
PTZ00056 199 glutathione peroxidase; Provisional 99.61
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.59
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.58
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.58
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.58
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.54
PLN02412167 probable glutathione peroxidase 99.54
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.53
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.53
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.49
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.47
PTZ00256183 glutathione peroxidase; Provisional 99.46
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.44
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.4
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.38
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.38
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.37
PRK10606 183 btuE putative glutathione peroxidase; Provisional 99.37
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.36
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.34
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.34
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.31
PRK13728181 conjugal transfer protein TrbB; Provisional 99.3
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.3
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.3
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.29
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.29
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.28
cd02969 171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.28
KOG0907|consensus106 99.26
TIGR03137 187 AhpC peroxiredoxin. This gene contains two invaria 99.26
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.26
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.25
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.24
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.22
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.22
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.22
PHA02278103 thioredoxin-like protein 99.21
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.21
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.21
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.19
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.19
KOG0910|consensus150 99.18
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.18
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.17
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.16
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.16
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.15
PRK13190 202 putative peroxiredoxin; Provisional 99.14
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.14
PRK10382 187 alkyl hydroperoxide reductase subunit C; Provision 99.13
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.13
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.12
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.12
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.1
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.1
PTZ00137 261 2-Cys peroxiredoxin; Provisional 99.05
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.05
PRK09381109 trxA thioredoxin; Provisional 99.05
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.04
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.03
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.01
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.0
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.99
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.99
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 98.99
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.99
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.98
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.97
COG3118 304 Thioredoxin domain-containing protein [Posttransla 98.97
PRK13599 215 putative peroxiredoxin; Provisional 98.95
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.94
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.94
cd03016 203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 98.93
PTZ00253 199 tryparedoxin peroxidase; Provisional 98.93
PRK15000 200 peroxidase; Provisional 98.93
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.93
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 98.9
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.9
PRK10996139 thioredoxin 2; Provisional 98.9
PTZ0005198 thioredoxin; Provisional 98.9
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.89
PRK13191 215 putative peroxiredoxin; Provisional 98.88
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.88
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 98.87
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.87
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.86
KOG2501|consensus157 98.86
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.84
KOG0908|consensus 288 98.84
PRK13189 222 peroxiredoxin; Provisional 98.81
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.81
PTZ00443 224 Thioredoxin domain-containing protein; Provisional 98.8
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.78
PTZ00102477 disulphide isomerase; Provisional 98.78
PLN02309457 5'-adenylylsulfate reductase 98.77
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.76
KOG0190|consensus493 98.73
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.73
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.73
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.69
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.64
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.55
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.54
PTZ00062 204 glutaredoxin; Provisional 98.52
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.49
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.49
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.47
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.45
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 98.45
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 98.42
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 98.4
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.37
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.37
PTZ00102 477 disulphide isomerase; Provisional 98.35
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.31
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 98.25
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.23
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.21
PHA0212575 thioredoxin-like protein 98.2
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.2
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 98.14
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.11
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.04
TIGR02187 215 GlrX_arch Glutaredoxin-like domain protein. This f 98.04
KOG0190|consensus 493 98.02
KOG1651|consensus171 97.99
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.95
KOG0191|consensus 383 97.82
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.81
cd03023 154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 97.78
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.67
PF13462 162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 97.5
KOG1731|consensus 606 97.43
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.38
COG4232569 Thiol:disulfide interchange protein [Posttranslati 97.29
KOG0912|consensus 375 97.27
cd03019 178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 97.22
KOG0191|consensus 383 97.2
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 97.2
KOG4277|consensus 468 97.2
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 97.18
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.08
PRK1120085 grxA glutaredoxin 1; Provisional 96.97
PF13728215 TraF: F plasmid transfer operon protein 96.96
cd02958114 UAS UAS family; UAS is a domain of unknown functio 96.85
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.83
KOG3425|consensus128 96.78
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 96.77
PRK10954 207 periplasmic protein disulfide isomerase I; Provisi 96.67
PRK13703248 conjugal pilus assembly protein TraF; Provisional 96.65
TIGR02739256 TraF type-F conjugative transfer system pilin asse 96.53
COG0450 194 AhpC Peroxiredoxin [Posttranslational modification 96.37
smart00594122 UAS UAS domain. 96.3
KOG0914|consensus265 96.25
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 95.87
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 95.87
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 95.87
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 95.74
KOG0911|consensus 227 95.72
PF04592 238 SelP_N: Selenoprotein P, N terminal region; InterP 95.71
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 95.55
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 95.54
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 95.53
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 95.45
PRK10877232 protein disulfide isomerase II DsbC; Provisional 95.43
KOG0855|consensus211 95.36
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 95.23
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 94.98
PHA03050108 glutaredoxin; Provisional 94.91
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 94.68
COG1651 244 DsbG Protein-disulfide isomerase [Posttranslationa 94.66
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 94.63
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 93.78
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 93.75
KOG2792|consensus280 93.7
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 93.67
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 93.11
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 92.95
KOG0852|consensus 196 92.89
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 92.54
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 92.31
KOG0913|consensus 248 91.11
PRK1032981 glutaredoxin-like protein; Provisional 91.08
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 90.94
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 90.75
PF06053 249 DUF929: Domain of unknown function (DUF929); Inter 90.0
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 90.0
PHA03075123 glutaredoxin-like protein; Provisional 89.69
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 89.29
PRK1063883 glutaredoxin 3; Provisional 88.76
KOG3414|consensus142 88.56
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 88.4
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 86.93
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 85.95
cd03025 193 DsbA_FrnE_like DsbA family, FrnE-like subfamily; c 85.21
PRK10824115 glutaredoxin-4; Provisional 85.04
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 84.61
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 84.43
PF01323 193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 84.39
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 83.03
KOG1752|consensus104 82.77
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 81.09
KOG3170|consensus240 80.34
PF13743 176 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. 80.32
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
Probab=99.71  E-value=1.8e-17  Score=104.13  Aligned_cols=63  Identities=38%  Similarity=0.807  Sum_probs=57.1

Q ss_pred             CCCccccccccCCCcccccccCCCCEEEEEEeCCCChhhhhhccHHHHHHHHhCcCCeEEEEEE
Q psy6924          21 RDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILEYKRTHIIKTF   84 (89)
Q Consensus        21 p~~~~~~~~~~~g~~~~l~~~~~gk~vvv~Fwa~wC~~C~~~~p~l~~l~~~~~~~~~~vi~~~   84 (89)
                      |++.+...|+++|+++++ ++++||++||+||++||++|++++|.|++++++|+++++.++++.
T Consensus         1 ~~~~~~~~w~~~~~~v~l-~~~~gk~vvl~F~a~~C~~C~~~~p~l~~l~~~~~~~~~~vi~i~   63 (126)
T cd03012           1 PEFEGILQWLNTDKPLSL-AQLRGKVVLLDFWTYCCINCLHTLPYLTDLEQKYKDDGLVVIGVH   63 (126)
T ss_pred             CCCcchhhhhcCCCccCH-HHhCCCEEEEEEECCCCccHHHHHHHHHHHHHHcCcCCeEEEEec
Confidence            566777789998889999 789999999999999999999999999999999999888888763



Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.

>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>KOG0908|consensus Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>KOG0190|consensus Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>KOG0190|consensus Back     alignment and domain information
>KOG1651|consensus Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>KOG1731|consensus Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG0912|consensus Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>KOG4277|consensus Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>KOG3425|consensus Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>KOG0914|consensus Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma [] Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>KOG0855|consensus Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>KOG2792|consensus Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG0852|consensus Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>KOG0913|consensus Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>KOG3414|consensus Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>KOG3170|consensus Back     alignment and domain information
>PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
2hyx_A 352 Structure Of The C-Terminal Domain Of Dipz From Myc 9e-04
>pdb|2HYX|A Chain A, Structure Of The C-Terminal Domain Of Dipz From Mycobacterium Tuberculosis Length = 352 Back     alignment and structure

Iteration: 1

Score = 38.5 bits (88), Expect = 9e-04, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Query: 29 WMNT--TEPLSLNSHLKNKIVIMDFFTYCCINC 59 W+NT +P+ L S L+ K+V++DF+ Y CINC Sbjct: 66 WLNTPGNKPIDLKS-LRGKVVLIDFWAYSCINC 97

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 2e-12
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 5e-11
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 3e-10
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 8e-09
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 Back     alignment and structure
 Score = 60.0 bits (145), Expect = 2e-12
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 22  DFCTKQEWMNTT--EPLSLNSHLKNKIVIMDFFTYCCINCMHILP 64
           D      W+NT   +P+ L   L+ K+V++DF+ Y CINC   +P
Sbjct: 59  DLKGITGWLNTPGNKPIDL-KSLRGKVVLIDFWAYSCINCQRAIP 102


>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.7
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.68
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.67
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.66
2f8a_A 208 Glutathione peroxidase 1; thioredoxin fold, struct 99.65
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.65
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.65
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.64
3raz_A151 Thioredoxin-related protein; structural genomics, 99.62
2i3y_A 215 Epididymal secretory glutathione peroxidase; thior 99.62
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.62
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.61
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.61
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.61
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.6
2r37_A 207 Glutathione peroxidase 3; plasma, structural genom 99.6
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.59
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.59
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.59
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.58
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.58
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.57
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.57
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.57
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.55
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.55
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.55
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.55
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.54
3u5r_E 218 Uncharacterized protein; structural genomics, PSI- 99.54
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.54
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.54
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.53
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.52
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.52
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.52
2cvb_A 188 Probable thiol-disulfide isomerase/thioredoxin; re 99.52
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.51
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.51
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.51
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.51
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.5
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.5
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.5
2c0d_A 221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.49
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.49
2pn8_A 211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.49
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.48
3ztl_A 222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.48
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.48
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.47
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.47
4evm_A138 Thioredoxin family protein; structural genomics, n 99.47
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.47
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.47
2ywi_A 196 Hypothetical conserved protein; uncharacterized co 99.47
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.47
1qmv_A 197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.46
1we0_A 187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.45
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.45
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.45
1zof_A 198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.44
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.44
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.44
1uul_A 202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.44
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.43
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.43
3qpm_A 240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.43
2ls5_A159 Uncharacterized protein; structural genomics, unkn 99.15
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.43
2bmx_A 195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.42
2i81_A 213 2-Cys peroxiredoxin; structural genomics consortiu 99.42
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.42
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.42
1zye_A 220 Thioredoxin-dependent peroxide reductase; catenane 99.41
2h01_A 192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.41
1n8j_A 186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.41
2b7k_A 200 SCO1 protein; metallochaperone, cytochrome C oxida 99.4
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.4
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.39
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.39
1nm3_A 241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.39
3me7_A170 Putative uncharacterized protein; electron transfe 99.38
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.38
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.38
3tjj_A 254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.37
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.37
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 99.07
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 99.37
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.36
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.36
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.36
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.35
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.35
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.35
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.34
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.34
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.32
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.29
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.28
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.24
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.24
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.22
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.21
1xcc_A 220 1-Cys peroxiredoxin; unknown function, structural 99.21
2v2g_A 233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.21
1prx_A 224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.21
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.21
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.2
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.2
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.19
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.19
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.18
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.18
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.18
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.18
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.17
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.17
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.16
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.15
3sbc_A 216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.14
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.14
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.13
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.12
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.12
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.12
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.12
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.12
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.12
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.12
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.12
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.11
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.11
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 99.11
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.11
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.1
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.1
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.1
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.1
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.1
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.1
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.1
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 98.68
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.09
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.09
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.09
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.08
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.08
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.08
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.08
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.08
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.07
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.07
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.06
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.06
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.05
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.05
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.05
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.05
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.05
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.04
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.04
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.03
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.03
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.03
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.03
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.02
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.02
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.01
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.01
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.0
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.0
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.0
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.0
2qsi_A137 Putative hydrogenase expression/formation protein; 99.0
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 98.99
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 98.99
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.99
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 98.99
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.98
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.96
1mek_A120 Protein disulfide isomerase; electron transport, r 98.96
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 98.95
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.94
3a2v_A 249 Probable peroxiredoxin; thioredoxin peroxidase, hy 98.94
3tue_A 219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 98.94
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 98.93
3keb_A 224 Probable thiol peroxidase; structural genomics, AP 98.92
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 98.92
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 98.92
3h93_A 192 Thiol:disulfide interchange protein DSBA; disulfid 98.92
3hd5_A 195 Thiol:disulfide interchange protein DSBA; protein 98.9
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.87
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.86
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.86
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 98.85
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.84
2kuc_A130 Putative disulphide-isomerase; structural genomics 98.84
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.83
1wmj_A130 Thioredoxin H-type; structural genomics, program f 98.82
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.82
3ira_A173 Conserved protein; methanosarcina mazei,structural 98.82
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 98.81
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 98.81
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 98.8
3hz8_A 193 Thiol:disulfide interchange protein DSBA; thiol-ox 98.8
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.8
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 98.8
3gyk_A 175 27KDA outer membrane protein; APC61738.2, siliciba 98.79
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.77
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.76
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.76
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 98.22
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.73
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.73
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 98.68
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 98.67
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 98.67
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.64
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 98.64
2znm_A 195 Thiol:disulfide interchange protein DSBA; thioredo 98.62
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 98.6
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.52
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.52
3feu_A 185 Putative lipoprotein; alpha-beta structure, struct 98.46
2rem_A 193 Disulfide oxidoreductase; disulfide oxidoreductase 98.43
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.4
1z6m_A 175 Conserved hypothetical protein; structural genomic 98.38
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 98.37
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 98.34
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.3
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 98.29
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.29
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 98.28
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 98.25
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 98.2
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.17
3l9v_A 189 Putative thiol-disulfide isomerase or thioredoxin; 98.16
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.12
1ttz_A87 Conserved hypothetical protein; structural genomic 98.11
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.09
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 98.02
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 97.98
4dvc_A 184 Thiol:disulfide interchange protein DSBA; pilus as 97.98
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 97.97
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 97.9
3l9s_A 191 Thiol:disulfide interchange protein; thioredoxin-f 97.9
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 97.83
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 97.77
1kte_A105 Thioltransferase; redox-active center, electron tr 97.67
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.64
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 97.6
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 97.58
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 97.55
3gha_A 202 Disulfide bond formation protein D; BDBD, DSBA-lik 97.52
3c7m_A 195 Thiol:disulfide interchange protein DSBA-like; red 97.44
3gn3_A 182 Putative protein-disulfide isomerase; MCSG, PSI, s 97.34
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 97.3
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 97.25
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.13
3f4s_A 226 Alpha-DSBA1, putative uncharacterized protein; thi 97.13
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.08
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.06
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.06
3bci_A 186 Disulfide bond protein A; thiol-disulfide oxidored 97.02
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.01
3gmf_A 205 Protein-disulfide isomerase; oxidoreductase, PSI-2 96.88
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.86
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.74
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.7
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 96.68
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 96.65
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.52
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 96.49
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 96.37
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.12
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 96.08
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 95.71
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 95.44
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 95.24
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 94.29
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 92.26
3kzq_A 208 Putative uncharacterized protein VP2116; protein w 92.15
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 91.77
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 91.75
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 91.47
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 91.28
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 90.59
2in3_A 216 Hypothetical protein; DSBA family, FRNE-like subfa 90.28
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 88.22
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 87.66
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 87.14
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 86.59
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 86.58
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 85.98
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 85.34
1z3e_A132 Regulatory protein SPX; bacterial transcription re 84.38
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 84.22
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 84.0
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 82.26
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
Probab=99.70  E-value=3.7e-17  Score=103.09  Aligned_cols=65  Identities=18%  Similarity=0.541  Sum_probs=56.5

Q ss_pred             ccCCCCccccccccCCCcccccccCCCCEEEEEEeCCCChhhhhh-ccHHHHHHHHhCcCCeEEEEEE
Q psy6924          18 FHGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHI-LPIPILIRHILEYKRTHIIKTF   84 (89)
Q Consensus        18 ~~ap~~~~~~~~~~~g~~~~l~~~~~gk~vvv~Fwa~wC~~C~~~-~p~l~~l~~~~~~~~~~vi~~~   84 (89)
                      -.+|+|. ..+|++.|+++++ ++++||++||+||++||++|+.+ +|.|++++++|+++++.++++.
T Consensus         4 ~~aP~f~-l~~~~~~g~~~~l-~~~~gk~vlv~f~a~wC~~C~~~~~~~l~~l~~~~~~~~v~~v~v~   69 (158)
T 3eyt_A            4 MKAPELQ-IQQWFNSATDLTL-ADLRGKVIVIEAFQMLCPGCVMHGIPLAQKVRAAFPEDKVAVLGLH   69 (158)
T ss_dssp             EECCCCC-EEEEESCSSCCCT-GGGTTSEEEEEEECTTCHHHHHTHHHHHHHHHHHSCTTTEEEEEEE
T ss_pred             CcCCCce-ehhhhcCCCccCH-HHhCCCEEEEEEECCcCcchhhhhhHHHHHHHHHhCcCCEEEEEEE
Confidence            4688887 3455566899999 89999999999999999999996 9999999999998888888664



>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.71
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.67
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.67
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.67
d2cvba1 187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.66
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.62
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.59
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.59
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.54
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.52
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.52
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.51
d2f8aa1 184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.48
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.43
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.33
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.32
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.3
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.3
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.28
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.25
d1uula_ 194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.24
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.2
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.19
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.18
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.18
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.18
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.17
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.17
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.17
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.17
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.14
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.13
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.12
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.11
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.11
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.1
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.1
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.09
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.09
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.09
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.08
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.07
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.07
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.06
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.04
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.03
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.02
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.01
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 98.99
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.99
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.98
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 98.96
d1n8ja_ 186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 98.96
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 98.95
d1qmva_ 197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 98.94
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.93
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.87
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.87
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.84
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.83
d2zcta1 237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 98.83
d1prxa_ 220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 98.62
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.53
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.52
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.51
d1xcca_ 219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 98.39
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.13
d1wjka_100 Thioredoxin-like structure containing protein C330 98.09
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 98.07
d1z6ma1 172 Hypothetical protein EF0770 {Enterococcus faecalis 97.97
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 97.96
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 97.92
d1beda_ 181 Disulfide-bond formation facilitator (DsbA) {Vibri 97.58
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.24
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 97.17
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 96.91
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 96.86
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 96.81
d1fvka_ 188 Disulfide-bond formation facilitator (DsbA) {Esche 96.68
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 94.99
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 94.86
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 93.03
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 92.86
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 92.73
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 92.6
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 91.46
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 91.05
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Tryparedoxin I
species: Trypanosoma brucei brucei [TaxId: 5702]
Probab=99.71  E-value=1.2e-17  Score=104.54  Aligned_cols=62  Identities=16%  Similarity=0.166  Sum_probs=51.2

Q ss_pred             cCCCCccccccccCCCcccccccCCCCEEEEEEeCCCChhhhhhccHHHHHHHHhC-cCCeEEEEEE
Q psy6924          19 HGRDFCTKQEWMNTTEPLSLNSHLKNKIVIMDFFTYCCINCMHILPIPILIRHILE-YKRTHIIKTF   84 (89)
Q Consensus        19 ~ap~~~~~~~~~~~g~~~~l~~~~~gk~vvv~Fwa~wC~~C~~~~p~l~~l~~~~~-~~~~~vi~~~   84 (89)
                      .+|++..   +.+.|+.+++ ++++||+|+|+|||+||++|++++|.|++++++|+ +.+++++++.
T Consensus         7 ~~P~~~~---~~~~~~~v~l-~~~~GK~vvl~FwatwC~~C~~~~p~l~~l~~~~~~~~~~~vi~is   69 (144)
T d1o73a_           7 YLPGATN---LLSKSGEVSL-GSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAKNFEVVLIS   69 (144)
T ss_dssp             TSCTTCC---BBCTTSCBCS-GGGTTCEEEEEEECTTCHHHHHHHHHHHHHHHHHTTTTTEEEEEEE
T ss_pred             CCCCcee---eccCCCEEeH-HHhCCCEEEEEeChhhCccchhhhHHHHHHHHHHhhccCeEEEEEe
Confidence            4666652   2344778999 89999999999999999999999999999999995 4568777653



>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure