Diaphorina citri psyllid: psy6952


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKIDFASLDQRNIYSNNELAFRTAERHLGIPALLDAEDMVEYAVPDRLSILTYLSQFYQVFVNQKQGKSPARCNMFVNSTLRPATHYQVHLIRSAGQLNLSSLLISMIAEGSAWSAYTVRNIGSSSPNSKILPDSPTTPTSPTQVVVLAIHNKGHVILGLKSIWLIGL
ccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEccccccccccccEEcccc
MKIDFASLDQRNIYSNNELAFRTAERHLGIPALLDAEDMVEYAVPDRLSILTYLSQFYQVFVNQ**********************YQVHLIRSAGQLNLSSLLISMIAEGSAWSAY**************************QVVVLAIHNKGHVILGLKSIWLIGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIDFASLDQRNIYSNNELAFRTAERHLGIPALLDAEDMVEYAVPDRLSILTYLSQFYQVFVNQKQGKSPARCNMFVNSTLRPATHYQVHLIRSAGQLNLSSLLISMIAEGSAWSAYTVRNIGSSSPNSKILPDSPTTPTSPTQVVVLAIHNKGHVILGLKSIWLIGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SJJ, chain A
Confidence level:very confident
Coverage over the Query: 1-119
View the alignment between query and template
View the model in PyMOL