Diaphorina citri psyllid: psy6968


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MKMSSNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY
cccccccccccccccCEECcccccEEEEEEccccccHHHHHHHHHHcccccccccccccEEEEEEEccEEEEEEEEccccccccccccccccc
*********FVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQE******RFKKEVVIDGHSHLLLIRDEGV*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMSSNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 GTPase-activating protein for the ADP ribosylation factor family (Potential). GTPase which may be involved in the degradation of expanded polyglutamine proteins through the ubiquitin-proteasome pathway.confidentQ96P47
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 GTPase-activating protein for the ADP ribosylation factor family (Potential). GTPase which may be involved in the degradation of expanded polyglutamine proteins through the ubiquitin-proteasome pathway.confidentQ8VHH5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0030578 [BP]PML body organizationprobableGO:0006996, GO:0006997, GO:0009987, GO:0030575, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0031593 [MF]polyubiquitin bindingprobableGO:0003674, GO:0043130, GO:0032182, GO:0005488, GO:0005515
GO:0034644 [BP]cellular response to UVprobableGO:0009628, GO:0051716, GO:0071478, GO:0071482, GO:0009314, GO:0050896, GO:0009987, GO:0008150, GO:0009411, GO:0009416, GO:0044763, GO:0071214, GO:0044699
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0034614 [BP]cellular response to reactive oxygen speciesprobableGO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0008060 [MF]ARF GTPase activator activityprobableGO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0032312 [BP]regulation of ARF GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0032012, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0065009, GO:0051336, GO:1900542, GO:0006140
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0000060 [BP]protein import into nucleus, translocationprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0006810, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHW, chain A
Confidence level:very confident
Coverage over the Query: 21-85
View the alignment between query and template
View the model in PyMOL