Psyllid ID: psy6968


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MKMSSNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY
cccccccccccccccEEEEcccccEEEEEEccccccHHHHHHHHHHcccccccccccccEEEEEEEccEEEEEEEEccccccccccccccccc
ccccccHHHcccccccEcccccccEEEEEEEcccccccHHHHHHccccEEEccccccccEEEEEEEccccEEEEEEccccccccccccccccc
mkmssnsdtfvtsheftlardvpdlrlgIVGSLASGKSALVHRFMTgaflqeespeggrfkkevVIDGHSHLLLirdegvppelqppnpsapy
mkmssnsdtfvtsheftlardvpdLRLGIVGSLASGKSALVHRFMTGAflqeespeggrFKKEVVIDGHSHLLlirdegvppelqppnpsapy
MKMSSNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY
**********VTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQ*******RFKKEVVIDGHSHLLLIR*****************
*********FVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQE******RFKKEVVIDGHSHLLLIRDEGV*************
************SHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY
****SNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPEL*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMSSNSDTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPELQPPNPSAPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q8VHH5 910 Arf-GAP with GTPase, ANK yes N/A 0.838 0.085 0.730 2e-30
Q96P47 875 Arf-GAP with GTPase, ANK yes N/A 0.838 0.089 0.730 3e-30
Q6NRL1 864 Arf-GAP with GTPase, ANK N/A N/A 0.838 0.090 0.730 4e-30
Q9UPQ3 857 Arf-GAP with GTPase, ANK no N/A 0.838 0.091 0.730 6e-29
Q8BXK8 857 Arf-GAP with GTPase, ANK no N/A 0.838 0.091 0.730 7e-29
Q9NGC3 995 Centaurin-gamma-1A OS=Dro no N/A 0.838 0.078 0.756 2e-28
Q8CGU4 1186 Arf-GAP with GTPase, ANK yes N/A 0.903 0.070 0.440 4e-18
Q3UHD9 1186 Arf-GAP with GTPase, ANK no N/A 0.903 0.070 0.428 7e-17
Q99490 1192 Arf-GAP with GTPase, ANK no N/A 0.903 0.070 0.416 1e-16
>sp|Q8VHH5|AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Agap3 PE=1 SV=1 Back     alignment and function desciption
 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 72/78 (92%)

Query: 8   DTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVID 67
           D+FV S E+TL+R VP+L++GIVG+L+SGKSALVHR++TG ++QEESPEGGRFKKE+V+D
Sbjct: 110 DSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD 169

Query: 68  GHSHLLLIRDEGVPPELQ 85
           G S+LLLIRDEG PPELQ
Sbjct: 170 GQSYLLLIRDEGGPPELQ 187




GTPase-activating protein for the ADP ribosylation factor family (Potential). GTPase which may be involved in the degradation of expanded polyglutamine proteins through the ubiquitin-proteasome pathway.
Mus musculus (taxid: 10090)
>sp|Q96P47|AGAP3_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=AGAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q6NRL1|AGAP1_XENLA Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis GN=agap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 Back     alignment and function description
>sp|Q8BXK8|AGAP1_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Agap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NGC3|CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster GN=cenG1A PE=2 SV=2 Back     alignment and function description
>sp|Q8CGU4|AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Agap2 PE=1 SV=1 Back     alignment and function description
>sp|Q3UHD9|AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Agap2 PE=1 SV=1 Back     alignment and function description
>sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
427780055 895 Putative gtpase-activating protein centa 0.838 0.087 0.782 2e-31
427783793 867 Putative gtpase-activating protein centa 0.838 0.089 0.782 2e-31
427783795 867 Putative gtpase-activating protein centa 0.838 0.089 0.782 2e-31
328715496157 PREDICTED: arf-GAP with GTPase, ANK repe 0.860 0.509 0.762 2e-30
242021832 859 Centaurin-gamma, putative [Pediculus hum 0.838 0.090 0.769 1e-29
195472743 927 GE18693 [Drosophila yakuba] gi|194174760 0.849 0.085 0.759 2e-29
7650487 1006 Centaurin Gamma 1A [Drosophila melanogas 0.849 0.078 0.759 2e-29
194860329 927 GG23894 [Drosophila erecta] gi|190661427 0.849 0.085 0.759 2e-29
355667453 780 ArfGAP with GTPase domain, ankyrin repea 0.838 0.1 0.743 2e-29
270001122 570 hypothetical protein TcasGA2_TC011430 [T 0.849 0.138 0.759 3e-29
>gi|427780055|gb|JAA55479.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 73/78 (93%)

Query: 8   DTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVID 67
           D+FV S E+TL+R VPD+RLGIVGSL SGKSALVHR++TG+++Q+ESPEGGRFKKE+V+D
Sbjct: 57  DSFVNSQEWTLSRSVPDIRLGIVGSLTSGKSALVHRYLTGSYMQDESPEGGRFKKEIVVD 116

Query: 68  GHSHLLLIRDEGVPPELQ 85
           GHSHLLLIRDEG PPELQ
Sbjct: 117 GHSHLLLIRDEGGPPELQ 134




Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427783793|gb|JAA57348.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427783795|gb|JAA57349.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|328715496|ref|XP_003245645.1| PREDICTED: arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242021832|ref|XP_002431347.1| Centaurin-gamma, putative [Pediculus humanus corporis] gi|212516615|gb|EEB18609.1| Centaurin-gamma, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195472743|ref|XP_002088659.1| GE18693 [Drosophila yakuba] gi|194174760|gb|EDW88371.1| GE18693 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|7650487|gb|AAF66064.1|AF254741_1 Centaurin Gamma 1A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194860329|ref|XP_001969560.1| GG23894 [Drosophila erecta] gi|190661427|gb|EDV58619.1| GG23894 [Drosophila erecta] Back     alignment and taxonomy information
>gi|355667453|gb|AER93871.1| ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|270001122|gb|EEZ97569.1| hypothetical protein TcasGA2_TC011430 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
FB|FBgn0028509 995 CenG1A "Centaurin gamma 1A" [D 0.838 0.078 0.756 3.5e-28
UNIPROTKB|C9J975 343 AGAP3 "Arf-GAP with GTPase, AN 0.870 0.236 0.716 5e-28
UNIPROTKB|E9PAL8 396 AGAP3 "Arf-GAP with GTPase, AN 0.870 0.204 0.716 5e-28
UNIPROTKB|H7C4F1194 AGAP3 "Arf-GAP with GTPase, AN 0.838 0.402 0.730 6.4e-28
UNIPROTKB|E1BB02 898 AGAP3 "Uncharacterized protein 0.870 0.090 0.716 1e-27
UNIPROTKB|E7ESL9 576 AGAP3 "Arf-GAP with GTPase, AN 0.849 0.137 0.734 1.1e-27
UNIPROTKB|I3L794 863 AGAP3 "Uncharacterized protein 0.870 0.093 0.716 1.1e-27
UNIPROTKB|I3LME1 901 AGAP3 "Uncharacterized protein 0.870 0.089 0.716 1.3e-27
UNIPROTKB|C9J8Z2117 AGAP1 "Arf-GAP with GTPase, AN 0.838 0.666 0.730 1.3e-27
UNIPROTKB|I3LTX4235 I3LTX4 "Uncharacterized protei 0.838 0.331 0.730 1.3e-27
FB|FBgn0028509 CenG1A "Centaurin gamma 1A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 309 (113.8 bits), Expect = 3.5e-28, Sum P(2) = 3.5e-28
 Identities = 59/78 (75%), Positives = 70/78 (89%)

Query:     8 DTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVID 67
             D+FV S E+T++R VPDLRLGIVGSL SGKSALVHR++TG+++QEESPEGGRFKKEV ID
Sbjct:   126 DSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFID 185

Query:    68 GHSHLLLIRDEGVPPELQ 85
             G S+LLLIRDEG  PE+Q
Sbjct:   186 GQSYLLLIRDEGGAPEMQ 203


GO:0008060 "ARF GTPase activator activity" evidence=ISS;NAS
GO:0007264 "small GTPase mediated signal transduction" evidence=NAS
GO:0005634 "nucleus" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0032312 "regulation of ARF GTPase activity" evidence=IEA
UNIPROTKB|C9J975 AGAP3 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PAL8 AGAP3 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H7C4F1 AGAP3 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BB02 AGAP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7ESL9 AGAP3 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L794 AGAP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LME1 AGAP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9J8Z2 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTX4 I3LTX4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96P47AGAP3_HUMANNo assigned EC number0.73070.83870.0891yesN/A
Q8VHH5AGAP3_MOUSENo assigned EC number0.73070.83870.0857yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
cd04103158 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) 1e-35
pfam08477116 pfam08477, Miro, Miro-like protein 6e-09
cd04142 198 cd04142, RRP22, Ras-related protein on chromosome 2e-06
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 3e-06
pfam00071162 pfam00071, Ras, Ras family 6e-05
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 2e-04
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 2e-04
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 2e-04
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 2e-04
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 3e-04
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 6e-04
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 6e-04
COG1100 219 COG1100, COG1100, GTPase SAR1 and related small G 8e-04
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 0.002
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 0.004
>gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase Back     alignment and domain information
 Score =  117 bits (296), Expect = 1e-35
 Identities = 45/61 (73%), Positives = 55/61 (90%)

Query: 25 LRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPPEL 84
          L+LGIVG+L SGKSALVHR++TG+++Q ESPEGGRFKKEV++DG SHLLLIRDEG  P+ 
Sbjct: 1  LKLGIVGNLRSGKSALVHRYLTGSYVQLESPEGGRFKKEVLVDGQSHLLLIRDEGGAPDA 60

Query: 85 Q 85
          Q
Sbjct: 61 Q 61


The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. GGAP has been shown to have high GTPase activity due to a direct intramolecular interaction between the N-terminal GTPase domain and the C-terminal ArfGAP domain. In human tissue, AGAP mRNA was detected in skeletal muscle, kidney, placenta, brain, heart, colon, and lung. Reduced expression levels were also observed in the spleen, liver, and small intestine. Length = 158

>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0084|consensus 205 99.88
KOG0094|consensus 221 99.86
KOG0092|consensus 200 99.86
KOG0080|consensus 209 99.84
KOG0394|consensus 210 99.83
KOG0098|consensus 216 99.81
KOG0095|consensus 213 99.8
cd04172 182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.8
cd01875 191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.79
KOG0078|consensus 207 99.79
cd04133 176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.79
KOG0393|consensus 198 99.79
cd04131 178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.78
KOG0087|consensus 222 99.77
cd01874 175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.76
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.76
cd04174 232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.76
KOG0086|consensus 214 99.74
cd04128 182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.74
cd04120 202 Rab12 Rab12 subfamily. Rab12 was first identified 99.73
cd01871 174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.72
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.72
KOG0079|consensus 198 99.72
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.72
cd04134 189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.71
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.7
PTZ00369 189 Ras-like protein; Provisional 99.7
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.7
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.7
cd04121 189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.7
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.69
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.69
cd04130 173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.68
PLN03071 219 GTP-binding nuclear protein Ran; Provisional 99.67
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.67
cd01870 175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.66
cd04107 201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.66
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.65
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.65
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.65
smart00174 174 RHO Rho (Ras homology) subfamily of Ras-like small 99.65
cd04102 202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.65
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 99.65
KOG0097|consensus 215 99.64
cd04144 190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.64
PLN00023 334 GTP-binding protein; Provisional 99.64
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.64
cd04135 174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.64
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.64
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.64
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.63
cd04132 187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.63
cd04118 193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.63
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.62
KOG0091|consensus 213 99.62
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.62
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.62
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.61
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.61
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 99.61
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.61
cd04110 199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.61
cd04125 188 RabA_like RabA-like subfamily. RabA was first iden 99.6
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.6
KOG0088|consensus 218 99.59
KOG0395|consensus 196 99.59
PLN03110 216 Rab GTPase; Provisional 99.59
COG1100 219 GTPase SAR1 and related small G proteins [General 99.58
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.58
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.58
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.57
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.57
KOG0093|consensus 193 99.57
cd04109 215 Rab28 Rab28 subfamily. First identified in maize, 99.57
cd04111 211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.56
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.56
smart00176 200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.56
PLN03108 210 Rab family protein; Provisional 99.55
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.55
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.55
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.55
cd00157 171 Rho Rho (Ras homology) family. Members of the Rho 99.55
cd04142 198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.55
cd04112 191 Rab26 Rab26 subfamily. First identified in rat pan 99.55
cd04129 187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.54
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.54
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.53
cd01873 195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.53
cd01862 172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.52
cd04147 198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.52
KOG0083|consensus 192 99.52
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.52
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.51
KOG0081|consensus 219 99.5
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.5
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.49
PLN03118 211 Rab family protein; Provisional 99.49
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.49
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.49
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.48
cd04137 180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.47
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.46
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.44
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.43
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.43
PLN00223181 ADP-ribosylation factor; Provisional 99.42
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.42
PTZ00133182 ADP-ribosylation factor; Provisional 99.42
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.42
cd04152 183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.41
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.41
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.38
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.36
cd04158 169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.35
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.34
KOG1673|consensus 205 99.33
cd04161 167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.31
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.3
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.29
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.28
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.28
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.26
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.25
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.23
KOG4252|consensus 246 99.23
smart00178 184 SAR Sar1p-like members of the Ras-family of small 99.22
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.22
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.22
KOG0096|consensus 216 99.21
KOG0070|consensus181 99.16
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.15
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.13
cd04105 203 SR_beta Signal recognition particle receptor, beta 99.12
KOG0073|consensus 185 99.1
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.08
cd01891 194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.07
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.07
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.06
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.05
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.05
PRK04213 201 GTP-binding protein; Provisional 99.04
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.04
PRK15494 339 era GTPase Era; Provisional 99.03
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.02
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 99.0
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.0
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.98
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.98
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.97
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.96
KOG4423|consensus 229 98.95
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 98.95
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 98.95
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.93
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.93
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.93
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.93
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.92
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 98.92
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.92
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.92
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.92
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.92
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 98.92
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.92
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 98.92
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.91
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.91
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.91
cd03269 210 ABC_putative_ATPase This subfamily is involved in 98.91
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.91
PF00005137 ABC_tran: ABC transporter This structure is on hol 98.9
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 98.9
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 98.9
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 98.9
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.9
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.9
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.89
PRK10908 222 cell division protein FtsE; Provisional 98.89
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.89
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.89
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 98.89
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 98.89
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 98.89
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 98.89
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 98.89
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.89
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.88
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.88
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.88
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.88
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 98.88
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 98.88
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 98.88
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 98.88
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 98.88
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.88
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.87
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 98.87
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.87
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 98.87
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.87
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 98.87
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.87
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 98.87
COG3638 258 ABC-type phosphate/phosphonate transport system, A 98.87
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.86
PRK00454 196 engB GTP-binding protein YsxC; Reviewed 98.86
PRK00093 435 GTP-binding protein Der; Reviewed 98.86
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.86
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.86
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 98.86
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.86
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 98.86
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 98.86
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 98.86
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 98.85
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 98.85
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 98.85
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.85
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 98.85
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.85
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.85
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 98.84
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.84
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 98.84
KOG0058|consensus 716 98.84
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 98.84
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.84
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 98.84
COG4525 259 TauB ABC-type taurine transport system, ATPase com 98.84
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 98.84
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 98.84
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 98.83
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.83
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.83
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 98.83
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 98.83
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.83
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.83
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 98.83
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 98.83
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 98.83
cd03246173 ABCC_Protease_Secretion This family represents the 98.83
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 98.83
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 98.82
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 98.82
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 98.82
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 98.82
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 98.82
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.82
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.82
PRK13536 340 nodulation factor exporter subunit NodI; Provision 98.82
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 98.82
KOG0071|consensus180 98.82
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.82
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.82
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.81
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 98.81
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 98.81
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.81
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.81
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 98.81
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 98.81
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.81
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 98.81
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 98.81
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 98.81
PRK13537 306 nodulation ABC transporter NodI; Provisional 98.8
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.8
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 98.8
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 98.8
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 98.8
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.8
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 98.8
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 98.8
KOG0705|consensus 749 98.8
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.8
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 98.8
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.8
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 98.8
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 98.8
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 98.79
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 98.79
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 98.79
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 98.79
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 98.79
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 98.79
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 98.79
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 98.79
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 98.79
cd03234 226 ABCG_White The White subfamily represents ABC tran 98.79
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.78
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 98.78
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.78
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 98.78
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 98.78
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.78
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.78
PRK03003 472 GTP-binding protein Der; Reviewed 98.78
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 98.78
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 98.78
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.77
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 98.77
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 98.77
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the 98.77
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 98.77
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 98.77
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 98.77
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 98.77
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 98.76
cd03299 235 ABC_ModC_like Archeal protein closely related to M 98.76
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 98.76
COG4619 223 ABC-type uncharacterized transport system, ATPase 98.76
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 98.76
COG4133 209 CcmA ABC-type transport system involved in cytochr 98.76
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 98.76
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 98.76
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 98.76
TIGR00968 237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.76
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.76
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 98.75
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 98.75
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 98.75
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.75
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 98.75
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 98.75
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.75
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 98.74
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 98.74
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 98.74
cd01895 174 EngA2 EngA2 subfamily. This CD represents the seco 98.74
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 98.74
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.74
KOG0074|consensus 185 98.74
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 98.74
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.74
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 98.74
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 98.73
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 98.73
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.73
COG0411 250 LivG ABC-type branched-chain amino acid transport 98.73
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 98.73
COG4987 573 CydC ABC-type transport system involved in cytochr 98.73
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 98.73
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 98.73
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.73
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 98.72
PRK10522 547 multidrug transporter membrane component/ATP-bindi 98.72
COG0410 237 LivF ABC-type branched-chain amino acid transport 98.72
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 98.72
cd01889 192 SelB_euk SelB subfamily. SelB is an elongation fac 98.72
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 98.72
PRK09984 262 phosphonate/organophosphate ester transporter subu 98.72
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 98.72
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 98.72
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 98.72
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 98.72
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 98.71
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 98.71
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.71
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 98.71
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 98.7
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 98.7
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.7
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 98.7
PRK13546 264 teichoic acids export protein ATP-binding subunit; 98.7
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 98.7
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 98.7
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 98.7
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.69
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 98.69
cd03217 200 ABC_FeS_Assembly ABC-type transport system involve 98.69
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.69
KOG0057|consensus 591 98.69
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 98.69
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 98.69
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 98.69
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 98.69
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 98.69
PRK03003 472 GTP-binding protein Der; Reviewed 98.68
cd01876 170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.68
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.68
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 98.68
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 98.68
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 98.68
cd01896 233 DRG The developmentally regulated GTP-binding prot 98.68
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 98.68
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 98.68
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.67
cd04167 213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.67
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 98.67
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 98.67
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.67
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 98.67
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 98.67
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.67
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 98.67
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 98.66
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.66
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 98.66
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 98.66
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 98.66
KOG0055|consensus 1228 98.66
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 98.66
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 98.66
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 98.66
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 98.66
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.65
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.65
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.65
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 98.65
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.65
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.65
COG2884 223 FtsE Predicted ATPase involved in cell division [C 98.65
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.65
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 98.64
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.64
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.64
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 98.64
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.64
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 98.64
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 98.64
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 98.64
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.63
PRK11147 635 ABC transporter ATPase component; Reviewed 98.63
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.63
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.63
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 98.63
COG1127 263 Ttg2A ABC-type transport system involved in resist 98.63
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.63
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 98.62
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 98.62
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.61
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 98.61
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 98.61
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.61
KOG0055|consensus 1228 98.61
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 98.61
PRK10938 490 putative molybdenum transport ATP-binding protein 98.61
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.61
PLN03232 1495 ABC transporter C family member; Provisional 98.61
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 98.6
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.6
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 98.6
PLN03130 1622 ABC transporter C family member; Provisional 98.6
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.6
COG4559 259 ABC-type hemin transport system, ATPase component 98.6
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 98.59
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 98.59
cd01881 176 Obg_like The Obg-like subfamily consists of five w 98.59
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.59
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 98.59
PRK03695 248 vitamin B12-transporter ATPase; Provisional 98.59
CHL00189 742 infB translation initiation factor 2; Provisional 98.58
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 98.58
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.58
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 98.58
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 98.58
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.57
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 98.57
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.57
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 98.57
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 98.57
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 98.57
PRK11147 635 ABC transporter ATPase component; Reviewed 98.56
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 98.56
COG1123 539 ATPase components of various ABC-type transport sy 98.56
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 98.56
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 98.55
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.55
PTZ00243 1560 ABC transporter; Provisional 98.55
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 98.54
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.54
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 98.54
cd00881 189 GTP_translation_factor GTP translation factor fami 98.53
COG3845 501 ABC-type uncharacterized transport systems, ATPase 98.53
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 98.52
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.52
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.52
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 98.51
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.51
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.51
COG4586 325 ABC-type uncharacterized transport system, ATPase 98.51
KOG0056|consensus 790 98.5
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.5
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.49
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 98.49
COG4152 300 ABC-type uncharacterized transport system, ATPase 98.49
COG4988 559 CydD ABC-type transport system involved in cytochr 98.49
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.49
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 98.48
PRK10938 490 putative molybdenum transport ATP-binding protein 98.48
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.48
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.47
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 98.46
KOG0075|consensus186 98.45
PLN03211 659 ABC transporter G-25; Provisional 98.45
PRK10535 648 macrolide transporter ATP-binding /permease protei 98.45
>KOG0084|consensus Back     alignment and domain information
Probab=99.88  E-value=7.6e-23  Score=130.86  Aligned_cols=69  Identities=23%  Similarity=0.327  Sum_probs=62.9

Q ss_pred             CeeeEEEECCCCCCHHHHHHHHHhCCCCCCCCCCcc-ee-EEEEEECCeEEEEEEEecCCCCCCCCCCCCC
Q psy6968          23 PDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGG-RF-KKEVVIDGHSHLLLIRDEGVPPELQPPNPSA   91 (93)
Q Consensus        23 ~~~kv~lvG~~g~GKtsl~~r~~~~~f~~~~~~t~~-~~-~~~~~~~g~~i~~~i~d~~g~~~~~~~~~~~   91 (93)
                      +.+|++|+|++|||||+|+.||..+.|.+.|..|.| +| .+++.++|+.++++||||+|||||+++..++
T Consensus         8 ylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~sy   78 (205)
T KOG0084|consen    8 YLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSY   78 (205)
T ss_pred             eEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhh
Confidence            448999999999999999999999999999999966 57 6899999999999999999999999876554



>KOG0094|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3ihw_A184 Crystal Structure Of The Ras-Like Domain Of Centg3 1e-25
2bmj_A 178 Gtpase Like Domain Of Centaurin Gamma 1 (Human) Len 7e-15
2iwr_A 178 Gtpase Like Domain Of Centaurin Gamma 1 (Human) Len 8e-15
>pdb|3IHW|A Chain A, Crystal Structure Of The Ras-Like Domain Of Centg3 Length = 184 Back     alignment and structure

Iteration: 1

Score = 110 bits (276), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 48/63 (76%), Positives = 60/63 (95%) Query: 23 PDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEGVPP 82 P+L++GIVG+L+SGKSALVHR++TG ++QEESPEGGRFKKE+V+DG S+LLLIRDEG PP Sbjct: 19 PELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPP 78 Query: 83 ELQ 85 ELQ Sbjct: 79 ELQ 81
>pdb|2BMJ|A Chain A, Gtpase Like Domain Of Centaurin Gamma 1 (Human) Length = 178 Back     alignment and structure
>pdb|2IWR|A Chain A, Gtpase Like Domain Of Centaurin Gamma 1 (Human) Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 4e-27
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 5e-21
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 4e-08
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 9e-08
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 5e-07
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 6e-07
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 1e-06
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 1e-06
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 2e-06
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 2e-06
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 2e-06
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 2e-06
2nzj_A 175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 2e-06
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 2e-06
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 3e-06
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 4e-06
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 4e-06
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 4e-06
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 7e-06
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 9e-06
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 1e-05
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 9e-05
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 3e-04
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 3e-04
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
 Score = 96.5 bits (241), Expect = 4e-27
 Identities = 50/78 (64%), Positives = 63/78 (80%)

Query: 8  DTFVTSHEFTLARDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVID 67
              +S    L    P+L++GIVG+L+SGKSALVHR++TG ++QEESPEGGRFKKE+V+D
Sbjct: 4  HHHHSSGRENLYFQGPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD 63

Query: 68 GHSHLLLIRDEGVPPELQ 85
          G S+LLLIRDEG PPELQ
Sbjct: 64 GQSYLLLIRDEGGPPELQ 81


>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 99.8
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.7
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.67
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.65
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.64
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 99.64
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 99.64
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.64
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 99.63
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.63
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 99.62
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.61
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.61
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.61
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.61
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 99.61
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.6
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.6
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.6
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.6
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.6
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 99.58
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.58
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.58
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.58
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.58
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.57
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 99.57
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.57
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.57
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.56
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.56
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.56
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.56
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.56
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.56
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.55
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.55
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.55
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.55
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.55
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 99.55
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.54
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.54
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.54
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.54
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.54
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.53
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.53
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 99.53
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.53
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.53
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 99.53
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 99.53
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.53
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.52
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 99.52
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 99.52
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.52
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 99.51
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.51
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.51
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.51
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.51
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.51
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.5
2nzj_A 175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.5
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.5
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.49
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.48
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 99.48
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.48
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 99.48
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.48
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.47
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.47
2fh5_B 214 SR-beta, signal recognition particle receptor beta 99.47
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 99.2
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 99.45
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.45
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.45
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.45
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.44
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.43
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.43
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 99.43
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.43
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.43
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 99.42
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 99.42
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.41
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 99.41
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.41
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 99.41
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.41
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.41
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.39
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.38
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 99.37
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.37
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.36
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.36
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 99.36
3llu_A 196 RAS-related GTP-binding protein C; structural geno 99.36
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.3
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.27
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.21
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.2
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.18
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.18
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.17
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.16
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.15
2ged_A193 SR-beta, signal recognition particle receptor beta 99.12
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.11
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 99.11
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.1
1nrj_B 218 SR-beta, signal recognition particle receptor beta 99.09
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.08
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 99.06
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 99.06
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 99.03
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.02
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 99.01
1b0u_A 262 Histidine permease; ABC transporter, transport pro 99.01
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.0
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.0
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.0
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.0
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 98.99
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 98.99
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 98.99
1ji0_A 240 ABC transporter; ATP binding protein, structural g 98.99
1g6h_A 257 High-affinity branched-chain amino acid transport 98.99
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.98
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.98
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 98.98
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.97
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 98.96
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 98.96
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 98.96
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 98.96
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 98.96
1sgw_A 214 Putative ABC transporter; structural genomics, P p 98.95
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 98.95
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.94
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 98.94
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 98.93
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 98.92
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 98.91
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 98.91
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 98.9
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 98.9
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.9
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 98.9
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 98.9
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 98.89
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 98.88
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 98.88
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.87
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 98.87
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.86
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 98.85
2ghi_A 260 Transport protein; multidrug resistance protein, M 98.84
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 98.82
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.81
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.81
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 98.8
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.8
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 98.79
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 98.79
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 98.79
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.77
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 98.77
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 98.77
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 98.76
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 98.76
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.72
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.72
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 98.72
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 98.71
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 98.7
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 98.68
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.68
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.68
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 98.67
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 98.65
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.65
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 98.63
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.62
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.59
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.59
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.59
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.58
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.58
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.57
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.57
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.54
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 98.54
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.49
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.47
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.46
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.45
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.44
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.42
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.42
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.4
3ohm_A 327 Guanine nucleotide-binding protein G(Q) subunit A; 98.4
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.4
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.39
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.39
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.39
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 98.39
2hf9_A 226 Probable hydrogenase nickel incorporation protein 98.39
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.37
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.35
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.35
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.34
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.33
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.33
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.33
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.29
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.28
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.28
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.28
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.28
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.27
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.27
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.26
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.26
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.25
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.24
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.22
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.21
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.21
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.2
4fid_A 340 G protein alpha subunit; RAS-like domain, all-heli 98.2
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.19
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.19
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.17
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.16
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 98.15
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.15
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.12
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.11
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.11
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.09
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.07
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 98.07
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.07
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.05
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.03
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.02
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.02
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.0
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.99
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 97.97
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.96
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.96
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.95
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.91
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.9
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.89
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.89
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.88
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.88
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.87
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.87
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.86
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.86
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.86
2og2_A 359 Putative signal recognition particle receptor; nuc 97.85
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 97.8
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.8
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.8
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.79
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.78
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.78
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.75
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.74
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.74
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 97.73
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.73
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.71
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.7
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 97.69
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.67
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.66
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.66
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.65
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.64
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 97.63
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.63
4a74_A 231 DNA repair and recombination protein RADA; hydrola 97.62
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 97.61
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 97.59
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 97.57
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.56
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.55
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.54
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.53
3kta_A182 Chromosome segregation protein SMC; structural mai 97.51
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 97.5
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.49
2f1r_A 171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.49
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.47
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 97.47
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 97.46
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.45
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.44
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.44
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.43
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 97.42
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 97.42
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 97.41
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.41
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 97.4
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.37
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 97.37
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.36
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.36
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 97.35
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.35
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 97.32
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.29
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.29
3kb2_A 173 SPBC2 prophage-derived uncharacterized protein YOR 97.28
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.25
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.25
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.25
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 97.24
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.23
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.23
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.23
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.22
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.21
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.2
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.2
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.2
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 97.19
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 97.19
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 97.19
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 97.16
2xtz_A 354 Guanine nucleotide-binding protein alpha-1 subuni; 97.16
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 97.15
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.15
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 97.14
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.14
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 97.13
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.12
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.12
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.11
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 97.1
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.1
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 97.1
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.09
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.08
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.08
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.08
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.07
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.06
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.04
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.04
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.02
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.02
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 97.02
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.02
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 97.01
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.01
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.01
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 97.01
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 97.01
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.0
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.0
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.97
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.97
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 96.96
1via_A 175 Shikimate kinase; structural genomics, transferase 96.96
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.96
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.92
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.91
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.91
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 96.9
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.89
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.89
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.89
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.88
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.88
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.88
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 96.88
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 96.87
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.87
3bos_A 242 Putative DNA replication factor; P-loop containing 96.87
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.87
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.85
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.85
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.84
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.83
2xtz_A 354 Guanine nucleotide-binding protein alpha-1 subuni; 96.82
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 96.81
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.81
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.78
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 96.77
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.77
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.76
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 96.75
2chg_A 226 Replication factor C small subunit; DNA-binding pr 96.75
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.75
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.74
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.74
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.73
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.73
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.73
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.72
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.72
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.71
1e6c_A 173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.7
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.69
1p9r_A 418 General secretion pathway protein E; bacterial typ 96.69
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.68
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.67
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.66
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 96.66
2vli_A 183 Antibiotic resistance protein; transferase, tunica 96.66
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.66
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 96.65
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 96.65
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.65
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.65
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 96.63
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.63
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.62
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.61
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.61
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.59
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.58
1e69_A 322 Chromosome segregation SMC protein; structural mai 96.57
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.57
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.57
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.55
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.53
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.52
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.52
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.51
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.51
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.51
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.5
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.5
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.49
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.49
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 96.48
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.46
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.45
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.45
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.43
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.41
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.41
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.39
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.39
2fna_A 357 Conserved hypothetical protein; structural genomic 96.38
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.37
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 96.36
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.36
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.35
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.33
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 96.33
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.32
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.31
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.31
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.29
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.29
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.27
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.26
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.26
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 96.26
3co5_A143 Putative two-component system transcriptional RES 96.25
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.25
3ice_A 422 Transcription termination factor RHO; transcriptio 96.21
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.2
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.19
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.18
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.18
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.17
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.15
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 96.15
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.14
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.11
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.1
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.09
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.09
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.08
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 96.08
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.05
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 96.04
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 96.03
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.03
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 96.03
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.03
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.02
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.80  E-value=4.1e-20  Score=119.87  Aligned_cols=67  Identities=22%  Similarity=0.370  Sum_probs=52.9

Q ss_pred             CeeeEEEECCCCCCHHHHHHHHHhCCCCCCCCCCcc-ee-EEEEEECCeEEEEEEEecCCCCCCCCCCC
Q psy6968          23 PDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGG-RF-KKEVVIDGHSHLLLIRDEGVPPELQPPNP   89 (93)
Q Consensus        23 ~~~kv~lvG~~g~GKtsl~~r~~~~~f~~~~~~t~~-~~-~~~~~~~g~~i~~~i~d~~g~~~~~~~~~   89 (93)
                      .++||++||++|||||||+.||+.+.|.++|.||.+ +| .+.+.+++..+++++|||+|||+|..+++
T Consensus        12 k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~   80 (216)
T 4dkx_A           12 RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIP   80 (216)
T ss_dssp             -CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHH
T ss_pred             CcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHH
Confidence            359999999999999999999999999999999954 55 67888999999999999999999988764



>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d2bmja1 175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 4e-11
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 6e-09
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 5e-08
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 5e-07
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 6e-07
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 1e-06
d2bcgy1 194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 1e-06
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 1e-06
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 1e-06
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-06
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-06
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 2e-06
d2ngra_ 191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 2e-06
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 5e-06
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 5e-06
d1ky3a_ 175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 5e-06
d2f7sa1 186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 7e-06
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 1e-05
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 1e-05
d1m7ba_ 179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 1e-05
d1kmqa_ 177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 1e-05
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-05
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 2e-05
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 2e-05
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 2e-05
d1vg8a_ 184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 3e-05
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-05
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 3e-05
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 4e-05
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 4e-05
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 5e-05
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 6e-05
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 9e-05
d1mh1a_ 183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 1e-04
d2a5ja1 173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 1e-04
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 1e-04
d2atxa1 185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 1e-04
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 2e-04
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 2e-04
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 4e-04
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 5e-04
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 5e-04
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.001
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 0.002
d2fh5b1 207 c.37.1.8 (B:63-269) Signal recognition particle re 0.003
d1svsa1 195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 0.003
d2bcjq2 200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 0.003
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Centaurin gamma 1, G domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 53.8 bits (128), Expect = 4e-11
 Identities = 30/60 (50%), Positives = 47/60 (78%)

Query: 20 RDVPDLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGRFKKEVVIDGHSHLLLIRDEG 79
          R +P+LRLG++G   SGKS+L+HRF+TG++   E  E  ++KKE+++DG +HL+LIR+E 
Sbjct: 1  RSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEA 60


>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.74
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.74
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.72
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.72
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.71
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.7
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.7
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.69
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.67
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.63
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.58
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.57
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1ky3a_ 175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.51
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.5
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.49
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.45
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.37
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.36
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.36
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.33
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.25
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.25
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.13
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.13
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.11
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 99.11
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.11
d2fh5b1 207 Signal recognition particle receptor beta-subunit 99.1
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.1
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.09
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.07
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.07
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.06
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.06
d2awna2 232 Maltose transport protein MalK, N-terminal domain 99.05
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.03
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.02
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.01
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 99.01
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.01
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.01
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.0
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.99
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 98.99
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.98
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 98.97
d1wf3a1 178 GTPase Era, N-terminal domain {Thermus thermophilu 98.8
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.77
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 98.73
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 98.67
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 98.65
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.61
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 98.55
d1mkya1 171 Probable GTPase Der, N-terminal and middle domains 98.44
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 98.41
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.38
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 98.33
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.12
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.08
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 97.95
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.85
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.81
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.76
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.75
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.73
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 97.71
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.7
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.68
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.66
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.65
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.62
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.61
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.59
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.54
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.53
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 97.53
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.52
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.51
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.48
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.47
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.47
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.46
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.45
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.44
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.44
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.44
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.43
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.43
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 97.42
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.42
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.41
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.4
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.39
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.36
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.32
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.32
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.32
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.32
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.31
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 97.3
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 97.3
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.28
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.27
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 97.26
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.24
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.22
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.22
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.22
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.21
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.21
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.21
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 97.18
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.18
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.16
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 97.13
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.12
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.11
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.11
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.09
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.08
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.03
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.01
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.01
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.99
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 96.95
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.95
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.91
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.9
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.9
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.9
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.89
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.88
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 96.88
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.88
d2qy9a2 211 GTPase domain of the signal recognition particle r 96.88
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.87
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.84
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.83
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.78
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.78
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 96.76
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 96.75
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.73
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 96.72
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.72
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.72
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 96.72
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 96.7
d1okkd2 207 GTPase domain of the signal recognition particle r 96.7
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 96.7
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.65
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 96.61
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 96.6
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.59
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.59
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 96.58
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.55
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 96.55
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.54
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 96.52
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 96.5
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.47
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.44
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.4
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 96.4
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 96.36
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.34
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.34
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.3
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 96.29
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.27
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 96.27
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.25
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.2
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.17
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 96.16
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.13
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.07
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.06
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.02
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.99
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.96
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.96
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.95
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 95.81
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 95.71
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.7
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.66
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.63
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 95.6
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 95.52
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 95.42
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.39
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 95.34
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 95.33
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.17
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.13
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.94
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.8
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.8
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.64
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.41
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.33
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 94.28
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.2
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 94.16
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.1
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.08
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 94.05
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 93.89
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 93.71
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 93.47
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.32
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 92.75
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.69
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.67
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 92.66
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 92.41
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 92.27
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.99
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 91.96
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 91.87
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.62
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 91.02
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 90.9
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 90.86
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.72
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.7
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.49
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 89.15
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 88.35
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.22
d1c9ka_ 180 Adenosylcobinamide kinase/adenosylcobinamide phosp 87.2
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 87.02
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 86.62
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 86.5
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 86.28
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 86.27
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.8
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 85.76
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 85.35
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 85.34
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 84.73
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 84.18
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 83.95
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 83.95
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 83.93
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 83.66
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 83.4
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 82.63
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 80.85
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 80.65
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.75  E-value=1.6e-18  Score=108.19  Aligned_cols=68  Identities=24%  Similarity=0.298  Sum_probs=60.9

Q ss_pred             eeeEEEECCCCCCHHHHHHHHHhCCCCCCCCCCcce-eEEEEEECCeEEEEEEEecCCCCCCCCCCCCC
Q psy6968          24 DLRLGIVGSLASGKSALVHRFMTGAFLQEESPEGGR-FKKEVVIDGHSHLLLIRDEGVPPELQPPNPSA   91 (93)
Q Consensus        24 ~~kv~lvG~~g~GKtsl~~r~~~~~f~~~~~~t~~~-~~~~~~~~g~~i~~~i~d~~g~~~~~~~~~~~   91 (93)
                      .+||+++|+.|||||||+.||+.+.|.+++.||.+. +.....+++..+.+++||++|+++|..+++..
T Consensus         3 ~iKvvllG~~~vGKTSli~r~~~~~f~~~~~~t~~~~~~~~~~~~~~~~~l~i~D~~g~~~~~~~~~~~   71 (191)
T d2ngra_           3 TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLS   71 (191)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHHSCCCSSCCCCSEEEEEEEEEETTEEEEEEEEEECCSGGGTTTGGGG
T ss_pred             ceEEEEECCCCcCHHHHHHHHHhCCCCCCcCCceeeecceeEeeCCceeeeeccccccchhhhhhhhhc
Confidence            489999999999999999999999999999999665 46778889999999999999999998887543



>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure