Diaphorina citri psyllid: psy6970


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
KYEVEFLLQQQWHDPRLEYFNQTTYDFLNAIHHHSDVWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQGSLHIFPFDDPTCSFAMESISYEQSAIEYVWKNDEDTLRKSPSLTTLNAYLITNRTISCPTKTTWR
cEEEEEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccEEEEEcccEEEEEEEEEEEEEEccccccccccccccccEEEEcEEEcccEEEEEEcccccEEEccccccccEEEEEEEEEEEEEEEECc
KYEVEFLLQQQWHDPRLEYFNQTTYDFLNAIHHHSDVWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQGSLHIFPFDDPTCSFAMESISYEQSAIEYVWKNDEDTLRKSPSLTTLNAYLITNRTISC*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KYEVEFLLQQQWHDPRLEYFNQTTYDFLNAIHHHSDVWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQGSLHIFPFDDPTCSFAMESISYEQSAIEYVWKNDEDTLRKSPSLTTLNAYLITNRTISCPTKTTWR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0016934 [MF]extracellular-glycine-gated chloride channel activityprobableGO:0003674, GO:0016933, GO:0008509, GO:0015276, GO:0015103, GO:0022803, GO:0005253, GO:0005254, GO:0005216, GO:0005215, GO:0005230, GO:0005231, GO:0005237, GO:0022891, GO:0022892, GO:0015108, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHW, chain A
Confidence level:very confident
Coverage over the Query: 1-139
View the alignment between query and template
View the model in PyMOL