Diaphorina citri psyllid: psy6978


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
cccccccEEEEEcccEEEEEEEccHHHHHHcccccccEEEccccHHHHHHHHHHccccEEEcccHHHHHHHHHHcccccccccEEEEEHHHHHHHHHccccEEEEEEEEEEc
****REGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMK*************VQMKSQISLRVQEEVLLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenosine kinase 1 ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Essential to sustain methyl recycling.confidentQ9SF85
Adenosine kinase ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives.confidentQ54MB5
Adenosine kinase ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides.confidentP55262

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006166 [BP]purine ribonucleoside salvageprobableGO:0044249, GO:0034641, GO:0006807, GO:0009163, GO:0072521, GO:0072522, GO:1901362, GO:0046129, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0055086, GO:0043101, GO:0044281, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0009119, GO:0046128, GO:0042455, GO:0046483, GO:0043094, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0043174, GO:0044237, GO:1901657, GO:0042451, GO:0019438, GO:1901659
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0016310 [BP]phosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0004001 [MF]adenosine kinase activityprobableGO:0019206, GO:0019205, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0046085 [BP]adenosine metabolic processprobableGO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LOO, chain A
Confidence level:very confident
Coverage over the Query: 4-105
View the alignment between query and template
View the model in PyMOL