Psyllid ID: psy6978

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
cccccccEEEEEcccEEEEEEEccHHHHHHcccccccEEEccccHHHHHHHHHHccccEEEccHHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHcccEEEEEEEEEEc
ccccccccEEEEcccEEEEEEEccHHHHHHccccccEEEEccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHccHHHHHHHHcHcEHEEEcccccccEEEEEEcEEEEEc
MADVREGLLlglgnplldisatvDASFLEKYNLKANNAILADEKHKDLYEDLIKnnnvdyiaggstqnTLRVAqvkpvqmksQISLrvqeevkpvqmkSQISLRVQEEVLLV
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQislrvqeevkpvqmksqislrvqeevllv
MADVREglllglgnpllDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
******GLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQV*************************************
****REG*LLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMK*************VQMKSQISLRVQEEVLLV
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
***VREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMKSQISLRVQEEVKPVQMKSQISLRVQEEVLLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
O49923 343 Adenosine kinase OS=Physc N/A N/A 0.616 0.201 0.652 3e-21
Q9SF85 344 Adenosine kinase 1 OS=Ara yes N/A 0.616 0.200 0.594 3e-20
P55263 362 Adenosine kinase OS=Homo yes N/A 0.633 0.196 0.605 7e-20
Q9LZG0 345 Adenosine kinase 2 OS=Ara no N/A 0.616 0.2 0.608 1e-19
Q64640 361 Adenosine kinase OS=Rattu yes N/A 0.633 0.196 0.591 4e-19
P55264 361 Adenosine kinase OS=Mus m yes N/A 0.633 0.196 0.591 4e-19
P55262 361 Adenosine kinase OS=Crice yes N/A 0.633 0.196 0.591 5e-19
Q54MB5 340 Adenosine kinase OS=Dicty yes N/A 0.580 0.191 0.545 3e-12
P47143 340 Adenosine kinase OS=Sacch yes N/A 0.580 0.191 0.463 4e-09
P78825 340 Adenosine kinase OS=Schiz yes N/A 0.562 0.185 0.447 6e-09
>sp|O49923|ADK_PHYPA Adenosine kinase OS=Physcomitrella patens subsp. patens GN=ADK PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 58/69 (84%)

Query: 6  EGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGS 65
          EG+LLG+GNPLLDIS  VD +FLEKY L  NNAILA++KH  +Y++L  N +V+YIAGG+
Sbjct: 4  EGVLLGMGNPLLDISCVVDDAFLEKYGLTLNNAILAEDKHLPMYKELAANPDVEYIAGGA 63

Query: 66 TQNTLRVAQ 74
          TQNT+R+AQ
Sbjct: 64 TQNTIRIAQ 72
ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Can also act on the cytokinin isopentenyladenosine to produce isopentenyladenosine monophosphate.
Physcomitrella patens subsp. patens (taxid: 145481)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 2EC: 0
>sp|Q9SF85|ADK1_ARATH Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1 Back     alignment and function description
>sp|P55263|ADK_HUMAN Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2 Back     alignment and function description
>sp|Q9LZG0|ADK2_ARATH Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1 Back     alignment and function description
>sp|Q64640|ADK_RAT Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3 Back     alignment and function description
>sp|P55264|ADK_MOUSE Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2 Back     alignment and function description
>sp|P55262|ADK_CRIGR Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1 SV=2 Back     alignment and function description
>sp|Q54MB5|ADK_DICDI Adenosine kinase OS=Dictyostelium discoideum GN=adk PE=3 SV=2 Back     alignment and function description
>sp|P47143|ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADO1 PE=1 SV=1 Back     alignment and function description
>sp|P78825|ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ado1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
383848386 345 PREDICTED: adenosine kinase 2-like [Mega 0.642 0.208 0.722 2e-23
345493960 386 PREDICTED: adenosine kinase 2-like [Naso 0.642 0.186 0.722 3e-23
322797538 400 hypothetical protein SINV_05090 [Solenop 0.642 0.18 0.736 6e-23
350416982 345 PREDICTED: adenosine kinase 1-like [Bomb 0.633 0.205 0.704 1e-22
260837380 349 hypothetical protein BRAFLDRAFT_107090 [ 0.633 0.203 0.676 1e-22
340725187 345 PREDICTED: adenosine kinase 2-like [Bomb 0.633 0.205 0.704 1e-22
66563613 345 PREDICTED: adenosine kinase 1-like isofo 0.642 0.208 0.694 5e-22
380021843 345 PREDICTED: adenosine kinase 2-like [Apis 0.642 0.208 0.694 6e-22
413923129 342 hypothetical protein ZEAMMB73_497854 [Ze 0.616 0.201 0.681 4e-21
328909585 290 adenosine kinase-like protein, partial [ 0.660 0.255 0.621 7e-21
>gi|383848386|ref|XP_003699832.1| PREDICTED: adenosine kinase 2-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (88%)

Query: 3  DVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIA 62
          D+REGLLLG+GNPLLDISATVD +FL+KY LK+NNAILA+EKHK +Y++LI+    D+IA
Sbjct: 4  DLREGLLLGMGNPLLDISATVDDNFLKKYELKSNNAILAEEKHKSMYDELIELYKADFIA 63

Query: 63 GGSTQNTLRVAQ 74
          GGS QNT+RVAQ
Sbjct: 64 GGSVQNTMRVAQ 75

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345493960|ref|XP_001601219.2| PREDICTED: adenosine kinase 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322797538|gb|EFZ19582.1| hypothetical protein SINV_05090 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350416982|ref|XP_003491199.1| PREDICTED: adenosine kinase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|260837380|ref|XP_002613682.1| hypothetical protein BRAFLDRAFT_107090 [Branchiostoma floridae] gi|229299070|gb|EEN69691.1| hypothetical protein BRAFLDRAFT_107090 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|340725187|ref|XP_003400955.1| PREDICTED: adenosine kinase 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66563613|ref|XP_391988.2| PREDICTED: adenosine kinase 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380021843|ref|XP_003694766.1| PREDICTED: adenosine kinase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|413923129|gb|AFW63061.1| hypothetical protein ZEAMMB73_497854 [Zea mays] Back     alignment and taxonomy information
>gi|328909585|gb|AEB61460.1| adenosine kinase-like protein, partial [Equus caballus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
UNIPROTKB|F1N468 345 ADK "Uncharacterized protein" 0.508 0.165 0.614 1.8e-14
MGI|MGI:87930 361 Adk "adenosine kinase" [Mus mu 0.508 0.157 0.596 4.7e-14
RGD|2046 361 Adk "adenosine kinase" [Rattus 0.508 0.157 0.596 4.7e-14
UNIPROTKB|P55263 362 ADK "Adenosine kinase" [Homo s 0.508 0.157 0.596 4.7e-14
UNIPROTKB|F1S2G5 362 ADK "Uncharacterized protein" 0.508 0.157 0.596 4.7e-14
UNIPROTKB|Q5ZMK9 359 ADK "Uncharacterized protein" 0.508 0.158 0.614 5.9e-14
TAIR|locus:2085079 344 ADK1 "adenosine kinase 1" [Ara 0.508 0.165 0.561 6.6e-14
UNIPROTKB|F1PJV5 362 ADK "Uncharacterized protein" 0.508 0.157 0.578 1e-13
UNIPROTKB|F1MX22 303 F1MX22 "Uncharacterized protei 0.508 0.188 0.578 1.4e-13
TAIR|locus:2142609 345 ADK2 "adenosine kinase 2" [Ara 0.508 0.165 0.578 1.9e-13
UNIPROTKB|F1N468 ADK "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 1.8e-14, P = 1.8e-14
 Identities = 35/57 (61%), Positives = 48/57 (84%)

Query:    18 DISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQ 74
             DISA VD  FL+KY+LK N+ ILA+EKHK+L+++L+K   V+Y AGGSTQN+++VAQ
Sbjct:    18 DISAVVDKDFLDKYSLKPNDQILAEEKHKELFDELVKKFKVEYHAGGSTQNSIKVAQ 74
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0006166 "purine ribonucleoside salvage" evidence=IEA
GO:0004001 "adenosine kinase activity" evidence=IEA
MGI|MGI:87930 Adk "adenosine kinase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2046 Adk "adenosine kinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P55263 ADK "Adenosine kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2G5 ADK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMK9 ADK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2085079 ADK1 "adenosine kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJV5 ADK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX22 F1MX22 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2142609 ADK2 "adenosine kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SF85ADK1_ARATH2, ., 7, ., 1, ., 2, 00.59420.61600.2005yesN/A
Q54MB5ADK_DICDI2, ., 7, ., 1, ., 2, 00.54540.58030.1911yesN/A
P55262ADK_CRIGR2, ., 7, ., 1, ., 2, 00.59150.63390.1966yesN/A
P55263ADK_HUMAN2, ., 7, ., 1, ., 2, 00.60560.63390.1961yesN/A
P55264ADK_MOUSE2, ., 7, ., 1, ., 2, 00.59150.63390.1966yesN/A
Q64640ADK_RAT2, ., 7, ., 1, ., 2, 00.59150.63390.1966yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
PLN02548 332 PLN02548, PLN02548, adenosine kinase 2e-31
PTZ00247 345 PTZ00247, PTZ00247, adenosine kinase; Provisional 1e-30
cd01168 312 cd01168, adenosine_kinase, Adenosine kinase (AK) c 3e-22
PRK15074 434 PRK15074, PRK15074, inosine/guanosine kinase; Prov 3e-09
PLN02813 426 PLN02813, PLN02813, pfkB-type carbohydrate kinase 0.002
>gnl|CDD|178163 PLN02548, PLN02548, adenosine kinase Back     alignment and domain information 
 Score =  112 bits (282), Expect = 2e-31
 Identities = 41/63 (65%), Positives = 53/63 (84%)

Query: 12 LGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLR 71
          +GNPLLDISA VD  FL+KY++K NNAILA+EKH  +Y++L    NV+YIAGG+TQN++R
Sbjct: 1  MGNPLLDISAVVDQDFLDKYDVKLNNAILAEEKHLPMYDELASKYNVEYIAGGATQNSIR 60

Query: 72 VAQ 74
          VAQ
Sbjct: 61 VAQ 63

Length = 332
>gnl|CDD|240328 PTZ00247, PTZ00247, adenosine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238573 cd01168, adenosine_kinase, Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>gnl|CDD|185033 PRK15074, PRK15074, inosine/guanosine kinase; Provisional Back     alignment and domain information
>gnl|CDD|215434 PLN02813, PLN02813, pfkB-type carbohydrate kinase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
KOG2854|consensus 343 99.93
PRK15074 434 inosine/guanosine kinase; Provisional 99.85
PLN02379 367 pfkB-type carbohydrate kinase family protein 99.84
PLN02813 426 pfkB-type carbohydrate kinase family protein 99.62
PLN02548 332 adenosine kinase 99.57
PTZ00247 345 adenosine kinase; Provisional 99.53
cd01168 312 adenosine_kinase Adenosine kinase (AK) catalyzes t 99.1
PRK11142 306 ribokinase; Provisional 98.19
cd01942 279 ribokinase_group_A Ribokinase-like subgroup A. Fou 98.08
PLN02341 470 pfkB-type carbohydrate kinase family protein 97.99
PTZ00292 326 ribokinase; Provisional 97.94
PRK09850 313 pseudouridine kinase; Provisional 97.93
cd01174 292 ribokinase Ribokinase catalyses the phosphorylatio 97.92
cd01166 294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 97.9
COG0524 311 RbsK Sugar kinases, ribokinase family [Carbohydrat 97.87
cd01944 289 YegV_kinase_like YegV-like sugar kinase. Found onl 97.85
cd01945 284 ribokinase_group_B Ribokinase-like subgroup B. Fou 97.8
cd01167 295 bac_FRK Fructokinases (FRKs) mainly from bacteria 97.75
cd01939 290 Ketohexokinase Ketohexokinase (fructokinase, KHK) 97.71
cd01941 288 YeiC_kinase_like YeiC-like sugar kinase. Found in 97.64
cd01172 304 RfaE_like RfaE encodes a bifunctional ADP-heptose 97.63
PRK09813 260 fructoselysine 6-kinase; Provisional 97.61
PF00294 301 PfkB: pfkB family carbohydrate kinase; InterPro: I 97.61
cd01947 265 Guanosine_kinase_like Guanosine kinase-like sugar 97.58
cd01940 264 Fructoselysine_kinase_like Fructoselysine kinase-l 97.58
PRK11316 473 bifunctional heptose 7-phosphate kinase/heptose 1- 97.55
cd01943 328 MAK32 MAK32 kinase. MAK32 is a protein found prima 97.53
cd00287 196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 97.52
PRK09954 362 putative kinase; Provisional 97.51
PLN02323 330 probable fructokinase 97.49
cd01937 254 ribokinase_group_D Ribokinase-like subgroup D. Fou 97.43
TIGR02198 315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 97.38
PRK09434 304 aminoimidazole riboside kinase; Provisional 97.36
PRK13508 309 tagatose-6-phosphate kinase; Provisional 97.26
cd01164 289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 97.24
PRK10294 309 6-phosphofructokinase 2; Provisional 97.23
TIGR02152 293 D_ribokin_bact ribokinase. This model describes ri 97.15
PRK09513 312 fruK 1-phosphofructokinase; Provisional 97.11
TIGR03828 304 pfkB 1-phosphofructokinase. This enzyme acts in co 96.95
PLN02543 496 pfkB-type carbohydrate kinase family protein 96.92
PLN02967 581 kinase 96.91
cd01946 277 ribokinase_group_C Ribokinase-like subgroup C. Fou 96.85
TIGR03168 303 1-PFK hexose kinase, 1-phosphofructokinase family. 96.8
PLN02630 335 pfkB-type carbohydrate kinase family protein 96.42
TIGR01231 309 lacC tagatose-6-phosphate kinase. This enzyme is p 95.76
KOG2855|consensus 330 92.92
KOG2947|consensus 308 87.02
COG1105 310 FruK Fructose-1-phosphate kinase and related fruct 83.86
>KOG2854|consensus Back     alignment and domain information 
Probab=99.93  E-value=6.3e-26  Score=185.56  Aligned_cols=106  Identities=48%  Similarity=0.707  Sum_probs=101.1

Q ss_pred             CCCCcccEEEecCceeeeEeecCHHHHHHcCCCCCceeeehHHHHHHHHHHhhCCCCeeecChHHHHHHHHHHhCCCCCC
Q psy6978           2 ADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMK   81 (112)
Q Consensus         2 ~~m~~~~IvgiGNpLvDi~a~Vdd~fL~~~gL~kG~m~L~de~~~~L~~eL~~~~~~~~~~GGSA~NTir~~a~Lg~~~~   81 (112)
                      +.+++.-++|+||||||+++.||++||+||||++|++++++++++.+|.++.+..+.++.||||++||+|++||+++.|+
T Consensus         2 ~~~~E~il~G~gnpLLD~~a~Vd~~~L~KygL~~n~ail~d~~~~~~~~E~~~~~~~~~~AGGs~qNt~R~aq~~~~~p~   81 (343)
T KOG2854|consen    2 SDLPEGILVGLGNPLLDISAVVDDEFLDKYGLKLNDAILADDKHLGLFDELMEGFNVKYSAGGSAQNTLRIAQWLLQQPG   81 (343)
T ss_pred             CCcccceeeccCccceeeeeccCHHHHHHcCCCCCcceecchhhHHHHHHHhhcccEEecCCchhHHHHHHHHHHccCCC
Confidence            45667778999999999999999999999999999999999999999999998889999999999999999999999999


Q ss_pred             ceeEEee------ccchhhhhhhhccceeeec
Q psy6978          82 SQISLRV------QEEVKPVQMKSQISLRVQE  107 (112)
Q Consensus        82 ~~~~fg~------~~~~~~~~~~~~~~~~~~~  107 (112)
                      +++|||.      +|.+++..+++|++.+.|.
T Consensus        82 ~~~f~GsvG~Dk~ge~l~~~~~~aGv~~~yq~  113 (343)
T KOG2854|consen   82 ATVFFGSVGKDKFGELLKSKARAAGVNVHYQV  113 (343)
T ss_pred             ceEEEeeccCchHHHHHHHHHHhcCceEEEEe
Confidence            9999999      8999999999999999885

>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PLN02323 probable fructokinase Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02967 kinase Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>KOG2855|consensus Back     alignment and domain information
>KOG2947|consensus Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1bx4_A 345 Structure Of Human Adenosine Kinase At 1.50 Angstro 4e-15
3loo_A 365 Crystal Structure Of Anopheles Gambiae Adenosine Ki 4e-14
3uq6_A 372 Adenosine Kinase From Schistosoma Mansoni In Comple 6e-09
3vaq_A 372 Adenosine Kinase From Schistosoma Mansoni In Comple 7e-09
3vas_A 370 Adenosine Kinase From Schistosoma Mansoni In Comple 3e-08
2xtb_A 347 Crystal Structure Of Trypanosoma Brucei Rhodesiense 3e-08
>pdb|1BX4|A Chain A, Structure Of Human Adenosine Kinase At 1.50 Angstroms Length = 345 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 52/74 (70%)
Query: 1  MADVREXXXXXXXXXXXDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDY 60
          M  VRE           DISA VD  FL+KY+LK N+ ILA++KHK+L+++L+K   V+Y
Sbjct: 1  MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEY 60
Query: 61 IAGGSTQNTLRVAQ 74
           AGGSTQN+++VAQ
Sbjct: 61 HAGGSTQNSIKVAQ 74
>pdb|3LOO|A Chain A, Crystal Structure Of Anopheles Gambiae Adenosine Kinase In Complex With P1,P4-Di(Adenosine-5) Tetraphosphate Length = 365 Back     alignment and structure
>pdb|3UQ6|A Chain A, Adenosine Kinase From Schistosoma Mansoni In Complex With Adenosine And Amp Length = 372 Back     alignment and structure
>pdb|3VAQ|A Chain A, Adenosine Kinase From Schistosoma Mansoni In Complex With Adenosine Length = 372 Back     alignment and structure
>pdb|3VAS|A Chain A, Adenosine Kinase From Schistosoma Mansoni In Complex With Adenosine In Occluded Loop Conformation Length = 370 Back     alignment and structure
>pdb|2XTB|A Chain A, Crystal Structure Of Trypanosoma Brucei Rhodesiense Adenosine Kinase Complexed With Activator Length = 347 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1bx4_A 345 Protein (adenosine kinase); human adenosine kinase 3e-32
3loo_A 365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 2e-30
3otx_A 347 Adenosine kinase, putative; AP5A, transferase-tran 2e-28
2abs_A 383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 2e-26
4e3a_A 352 Sugar kinase protein; structural genomics, protein 6e-09
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Length = 345 Back     alignment and structure
 Score =  114 bits (287), Expect = 3e-32
 Identities = 45/74 (60%), Positives = 61/74 (82%)

Query: 1  MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDY 60
          M  VRE +L G+GNPLLDISA VD  FL+KY+LK N+ ILA++KHK+L+++L+K   V+Y
Sbjct: 1  MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEY 60

Query: 61 IAGGSTQNTLRVAQ 74
           AGGSTQN+++VAQ
Sbjct: 61 HAGGSTQNSIKVAQ 74
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Length = 365 Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Length = 347 Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Length = 383 Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Length = 352 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
3uq6_A 372 Adenosine kinase, putative; ribokinase, transferas 99.94
3loo_A 365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 99.8
3otx_A 347 Adenosine kinase, putative; AP5A, transferase-tran 99.78
3vas_A 370 Putative adenosine kinase; ribokinase, enzyme, tra 99.77
4e3a_A 352 Sugar kinase protein; structural genomics, protein 99.76
1bx4_A 345 Protein (adenosine kinase); human adenosine kinase 99.51
2abs_A 383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 99.29
2hlz_A 312 Ketohexokinase; non-protein kinase, creatine kinas 98.42
1rkd_A 309 Ribokinase; carbohydrate kinase, ribose, nucleotid 98.39
2f02_A 323 Tagatose-6-phosphate kinase; LACC, structural geno 98.36
3h49_A 325 Ribokinase; transferase,PFKB family,sugar kinase Y 98.36
2pkf_A 334 Adenosine kinase; transferase, S genomics, TB stru 98.34
2c4e_A 302 Sugar kinase MJ0406; transferase, nucleoside kinas 98.3
3ikh_A 299 Carbohydrate kinase; transferase,kinase,SAD,ribose 98.29
3bf5_A 306 Ribokinase related protein; 10640157, putative rib 98.27
3go6_A 310 Ribokinase RBSK; phosphofructokinase, carbohydrate 98.26
2rbc_A 343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 98.26
3b1n_A 326 Ribokinase, putative; rossmann fold, ATP binding, 98.26
2fv7_A 331 Ribokinase; structural genomics, structural genomi 98.24
1tyy_A 339 Putative sugar kinase; ribokinase fold, alpha/beta 98.23
2jg1_A 330 Tagatose-6-phosphate kinase; phosphoryl transfer, 98.19
3pl2_A 319 Sugar kinase, ribokinase family; PFKB PFAM motif, 98.19
3kzh_A 328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 98.18
3ry7_A 304 Ribokinase; transferase; 2.15A {Staphylococcus aur 98.16
4du5_A 336 PFKB; structural genomics, PSI-biology, NEW YORK s 98.15
3cqd_A 309 6-phosphofructokinase isozyme 2; phosphofructokina 98.13
2ajr_A 331 Sugar kinase, PFKB family; TM0828, possible 1-phos 98.13
2nwh_A 317 AGR_C_3442P, carbohydrate kinase; structural genom 98.12
2qcv_A 332 Putative 5-dehydro-2-deoxygluconokinase; structura 98.07
3lhx_A 319 Ketodeoxygluconokinase; structural genomics, PSI-2 97.98
2dcn_A 311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 97.97
3ljs_A 338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 97.96
2abq_A 306 Fructose 1-phosphate kinase; dimer, structural gen 97.95
3hj6_A 327 Fructokinase, FRK; fructose, transferase, carbohyd 97.94
1vm7_A 311 Ribokinase; TM0960, structural genomics, JCSG, pro 97.93
3umo_A 309 6-phosphofructokinase isozyme 2; glycolysis, trans 97.88
2qhp_A 296 Fructokinase; NP_810670.1, PFKB family carbohydrat 97.84
3ewm_A 313 Uncharacterized sugar kinase PH1459; carbohydrate 97.83
2jg5_A 306 Fructose 1-phosphate kinase; 1-phosphofructokinase 97.81
3iq0_A 330 Putative ribokinase II; transferase,kinase,SAD,rib 97.81
3ktn_A 346 Carbohydrate kinase, PFKB family; PFKB family,ribo 97.79
2v78_A 313 Fructokinase; transferase, PFKB family carbohydrat 97.79
3ie7_A 320 LIN2199 protein; phosphofructokinases, transferase 97.73
4e69_A 328 2-dehydro-3-deoxygluconokinase; putative sugar kin 97.72
1v1a_A 309 2-keto-3-deoxygluconate kinase; ATP, structural ge 97.69
4gm6_A 351 PFKB family carbohydrate kinase; enzyme function i 97.52
4e84_A 352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 97.4
3kd6_A 313 Carbohydrate kinase, PFKB family; nucleoside kinas 97.15
2afb_A 351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 96.18
1vk4_A 298 PFKB carbohydrate kinase TM0415; structural genomi 96.04
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
Probab=99.94  E-value=6.6e-27  Score=185.87  Aligned_cols=105  Identities=34%  Similarity=0.530  Sum_probs=96.3

Q ss_pred             CCCCCcccEEEecCceeeeEeecCHHHHHHcCCCCCceeeehHHHHHHHHHHhhCCCCeeecChHHHHHHHHHHhCCCCC
Q psy6978           1 MADVREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQM   80 (112)
Q Consensus         1 ~~~m~~~~IvgiGNpLvDi~a~Vdd~fL~~~gL~kG~m~L~de~~~~L~~eL~~~~~~~~~~GGSA~NTir~~a~Lg~~~   80 (112)
                      |++++++.|+||||||||++++|||+||++|+|+||+|+|+++++.++|.++.+..+.++.||||++||+++++|||.++
T Consensus        21 ~~~~~~~~v~giGnalvDi~~~v~d~~l~~~~l~kg~m~l~~~~~~~~~~~~~~~~~~~~~~GGsa~N~a~~la~LG~~~  100 (372)
T 3uq6_A           21 MHDLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEIQKKKKLNYIAGGATLNTVKMIQWIIQKP  100 (372)
T ss_dssp             --CCCTTCEEEEECCEEEEEEECCTHHHHHTTCCTTEEEECCGGGTTHHHHHHTSSSCEEEECCHHHHHHHHHHHHHCST
T ss_pred             ccCCCCCeEEEECCceeeEEEEeCHHHHHHcCCCCCceEEcCHHHHHHHHHHhccCCeEEeCCcHHHHHHHHHHHcCCCC
Confidence            45667788999999999999999999999999999999999999999999998888889999999999999999999988


Q ss_pred             CceeEEee------ccchhhhhhhhccceee
Q psy6978          81 KSQISLRV------QEEVKPVQMKSQISLRV  105 (112)
Q Consensus        81 ~~~~~fg~------~~~~~~~~~~~~~~~~~  105 (112)
                      ..+.|+|.      ++.++.-+++.||..+.
T Consensus       101 ~~~~fiG~VG~D~~G~~l~~~L~~~GV~~~~  131 (372)
T 3uq6_A          101 FVCSYVGCIGADIQGKYIKNDCSALDLVTEF  131 (372)
T ss_dssp             TSEEEEEEECSSHHHHHHHHHHHHTTCEECC
T ss_pred             CcEEEEeeecCCHHHHHHHHHHHHcCCCcee
Confidence            89999996      77899999999997654
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1bx4a_ 342 c.72.1.1 (A:) Adenosine kinase {Human (Homo sapien 2e-25
d2absa1 350 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma g 2e-19
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: Adenosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 95.6 bits (236), Expect = 2e-25
 Identities = 44/72 (61%), Positives = 60/72 (83%)

Query: 4  VREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAG 63
          VRE +L G+GNPLLDISA VD  FL+KY+LK N+ ILA++KHK+L+++L+K   V+Y AG
Sbjct: 1  VRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAG 60

Query: 64 GSTQNTLRVAQV 75
          GSTQN+++VAQ 
Sbjct: 61 GSTQNSIKVAQW 72
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Length = 350 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d1bx4a_ 342 Adenosine kinase {Human (Homo sapiens) [TaxId: 960 99.8
d2absa1 350 Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} 99.78
d1rkda_ 306 Ribokinase {Escherichia coli [TaxId: 562]} 98.22
d1tyya_ 304 Aminoimidazole riboside kinase {Salmonella typhimu 98.18
d2fv7a1 308 Ribokinase {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2abqa1 306 Fructose 1-phosphate kinase FruB {Bacillus halodur 98.09
d1v19a_ 302 2-keto-3-deoxygluconate kinase {Thermus thermophil 97.96
d1vm7a_ 299 Ribokinase {Thermotoga maritima [TaxId: 2336]} 97.95
d2dcna1 308 Hypothetical fructokinase ST2478 {Sulfolobus tokod 97.91
d2f02a1 313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 97.86
d2afba1 333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 97.64
d2ajra1 319 Putative sugar kinase TM0828 {Thermotoga maritima 97.52
d1vk4a_ 288 Hypothetical protein TM0415 {Thermotoga maritima [ 96.67
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: Adenosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.80  E-value=8.5e-20  Score=137.56  Aligned_cols=102  Identities=46%  Similarity=0.729  Sum_probs=91.4

Q ss_pred             CCcccEEEecCceeeeEeecCHHHHHHcCCCCCceeeehHHHHHHHHHHhhCCCCeeecChHHHHHHHHHHhCCCCCC-c
Q psy6978           4 VREGLLLGLGNPLLDISATVDASFLEKYNLKANNAILADEKHKDLYEDLIKNNNVDYIAGGSTQNTLRVAQVKPVQMK-S   82 (112)
Q Consensus         4 m~~~~IvgiGNpLvDi~a~Vdd~fL~~~gL~kG~m~L~de~~~~L~~eL~~~~~~~~~~GGSA~NTir~~a~Lg~~~~-~   82 (112)
                      |+++.|+|||||+||+++++||+||++++++||.|++.++.+.+++.++......+..+||+++|+++++++++.+.+ .
T Consensus         1 ~~~~~il~iG~~~vD~~~~vd~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~GG~~~N~a~~~a~~l~~lG~~   80 (342)
T d1bx4a_           1 VRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKA   80 (342)
T ss_dssp             CCTTCEEEECCCEEEEEEECCHHHHHHTTCCSSEEEECCGGGHHHHHHHHHHSCCEEEEECHHHHHHHHHHHHHCSSTTC
T ss_pred             CCCCEEEEECcceEEEEEEeCHHHHHHcCCCCCceeechhhHHHHHHHhhcccceEEeCCcHHHHHHHHHHHhccccCce
Confidence            678889999999999999999999999999999999999999999999987778888999999999999888766654 7


Q ss_pred             eeEEee------ccchhhhhhhhccceee
Q psy6978          83 QISLRV------QEEVKPVQMKSQISLRV  105 (112)
Q Consensus        83 ~~~fg~------~~~~~~~~~~~~~~~~~  105 (112)
                      +.|+|.      ++.++.-+++.||..+.
T Consensus        81 ~~~ig~vG~D~~G~~i~~~l~~~GVd~~~  109 (342)
T d1bx4a_          81 ATFFGCIGIDKFGEILKRKAAEAHVDAHY  109 (342)
T ss_dssp             EEEEEEEESSHHHHHHHHHHHHTTCEEEE
T ss_pred             EEEEeecCCChhhhhhhhhhhhhccccee
Confidence            888876      78899999999997653
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure