Diaphorina citri psyllid: psy6987

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF

cEEEEEEECcccccEEEEEccccccHHHHHHcccccEEcccccccccccHHHHHHHHHHHHHHcccccccCCcccccccHHHHHHHHHHHcccccEEEccccccccccEEEEcccccccccccEEEEEEEcccEEEcccccEEEEEEEEEEccccEEEEEcccEEEEEccccccccccccccEEEccHHHHccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tubulin polyglutamylase TTLL5	Polyglutamylase which preferentially modifies alpha-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step. Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction.	confident	Q5R978
Tubulin polyglutamylase TTLL5	Polyglutamylase which preferentially modifies alpha-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step (By similarity). Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction.	confident	Q6EMB2
Tubulin polyglutamylase TTLL5	Polyglutamylase which preferentially modifies alpha-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step. Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction.	confident	Q8CHB8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0070736 [MF]	protein-glycine ligase activity, initiating	probable	GO:0070735, GO:0003824, GO:0016881, GO:0016879, GO:0003674, GO:0016874
GO:0044441 [CC]	cilium part	probable	GO:0005575, GO:0043231, GO:0031514, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422
GO:0018094 [BP]	protein polyglycylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0018095 [BP]	protein polyglutamylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TIG, chain A
Confidence level:very confident
Coverage over the Query: 2-186
View the alignment between query and template
View the model in PyMOL