Psyllid ID: psy6987

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF
cEEEEEEEEcccccEEEEEccccccHHHHHHcccccEEcccccccccccHHHHHHHHHHHHHHcccccccEEcccccccHHHHHHHHHHHcccccEEEccccccccccEEEEcccccccccccEEEEEEEcccEEEcccccEEEEEEEEEEccccEEEEEcccEEEEEccccccccccccccEEEccHHHHccccccccccccc
cEEccEEEccccccEEEEEccccccHHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHccccccccccccEEccHHHHHHHHHHHHccccEEEcccccccccEEEEEccHHcccccccEEEEEEEcccEEEcccEEEEEEEEEEEccccEEEEEEcccEEEEEEEEcccccccccccEEEEEEEEEEcccccccccccc
mvflnlgvtsdvadfnllwsglhpkpqtlrslaphqrvnhfprsyeltrkDRLYKNIEKMqhskgfkhfdfipstfvmpgdfrELTIShyrtrgpwivkpvassrgrgiyivdtpdevpleESVVVAKYIekpllveghkcdlrLYVVVTSYDPLIIYMYEEGLVRFATvkydsgrkhlwnpcmhlcnysinkhhsdyikdmnf
MVFLNLGVTSDVADFNLLWSGLHPKPQtlrslaphqrvnhfprsyeltrkdRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTIshyrtrgpwivkpvassrgrgiyivdtpdevpleESVVVAKYIEKPllveghkcdlrlYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF
*VFLNLGVTSDVADFNLLWSGLHPK************VNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDY******
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSD*******
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFLNLGVTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q8CHB8 1328 Tubulin polyglutamylase T yes N/A 0.911 0.140 0.602 2e-69
Q6EEF3 1299 Tubulin polyglutamylase T N/A N/A 0.911 0.143 0.602 5e-68
Q6EMB2 1281 Tubulin polyglutamylase T yes N/A 0.911 0.145 0.602 5e-68
Q5R978 1299 Tubulin polyglutamylase T yes N/A 0.911 0.143 0.602 6e-68
Q14679 1199 Tubulin polyglutamylase T no N/A 0.897 0.152 0.451 9e-43
Q80UG8 1193 Tubulin polyglutamylase T no N/A 0.897 0.153 0.451 3e-42
Q23MT7 1189 Probable beta-tubulin pol N/A N/A 0.897 0.153 0.389 5e-36
Q9BWV7 592 Probable tubulin polyglut no N/A 0.921 0.317 0.416 4e-35
A4Q9E8 822 Tubulin polyglutamylase T no N/A 0.950 0.236 0.402 9e-35
A4Q9E4 540 Probable tubulin polyglut no N/A 0.921 0.348 0.416 1e-34
>sp|Q8CHB8|TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus GN=Ttll5 PE=2 SV=3 Back     alignment and function desciption
 Score =  261 bits (668), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/186 (60%), Positives = 150/186 (80%)

Query: 14  DFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIP 73
           D+NL+W+G H KP  LR+L+  Q+VNHFPRSYELTRKDRLYKNI +MQH+ GFK F  +P
Sbjct: 95  DYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILP 154

Query: 74  STFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKP 133
            TF++P ++ E   S+ + RGPWIVKPVASSRGRG+Y+++ P+++ LEE+++V++YI  P
Sbjct: 155 QTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNP 214

Query: 134 LLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINK 193
           LL++  K D+RLYV+VTSYDPL+IY+YEEGL RFATV+YD G K++ N  MHL NYS+NK
Sbjct: 215 LLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNK 274

Query: 194 HHSDYI 199
              DY+
Sbjct: 275 KSGDYV 280
Polyglutamylase which preferentially modifies alpha-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step. Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q6EEF3|TTLL5_CHLAE Tubulin polyglutamylase TTLL5 OS=Chlorocebus aethiops GN=TTLL5 PE=2 SV=2 Back     alignment and function description
>sp|Q6EMB2|TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens GN=TTLL5 PE=1 SV=3 Back     alignment and function description
>sp|Q5R978|TTLL5_PONAB Tubulin polyglutamylase TTLL5 OS=Pongo abelii GN=TTLL5 PE=2 SV=1 Back     alignment and function description
>sp|Q14679|TTLL4_HUMAN Tubulin polyglutamylase TTLL4 OS=Homo sapiens GN=TTLL4 PE=1 SV=2 Back     alignment and function description
>sp|Q80UG8|TTLL4_MOUSE Tubulin polyglutamylase TTLL4 OS=Mus musculus GN=Ttll4 PE=2 SV=3 Back     alignment and function description
>sp|Q23MT7|TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) GN=Ttll6a PE=4 SV=1 Back     alignment and function description
>sp|Q9BWV7|TTLL2_HUMAN Probable tubulin polyglutamylase TTLL2 OS=Homo sapiens GN=TTLL2 PE=5 SV=3 Back     alignment and function description
>sp|A4Q9E8|TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus GN=Ttll6 PE=2 SV=1 Back     alignment and function description
>sp|A4Q9E4|TTLL2_MOUSE Probable tubulin polyglutamylase TTLL2 OS=Mus musculus GN=Ttll2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
270009877 844 hypothetical protein TcasGA2_TC009196 [T 0.946 0.228 0.792 7e-92
189238931 843 PREDICTED: similar to CG31108 CG31108-PA 0.946 0.228 0.792 8e-92
157116542 1057 hypothetical protein AaeL_AAEL007638 [Ae 0.950 0.183 0.716 1e-84
170055542 1046 conserved hypothetical protein [Culex qu 0.950 0.185 0.716 2e-83
347971634 1098 AGAP004288-PB [Anopheles gambiae str. PE 0.946 0.175 0.699 8e-83
347971636 1115 AGAP004288-PA [Anopheles gambiae str. PE 0.946 0.173 0.699 8e-83
307206995 670 Tubulin polyglutamylase TTLL5 [Harpegnat 0.926 0.282 0.714 4e-82
340714092 807 PREDICTED: tubulin polyglutamylase TTLL5 0.916 0.231 0.721 6e-82
380026047 811 PREDICTED: tubulin polyglutamylase TTLL5 0.946 0.237 0.699 9e-82
350417501 681 PREDICTED: tubulin polyglutamylase TTLL5 0.916 0.274 0.721 1e-81
>gi|270009877|gb|EFA06325.1| hypothetical protein TcasGA2_TC009196 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  342 bits (876), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (89%)

Query: 8   VTSDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFK 67
           V  + +DFNLLW+G HPKP  LRSLAPHQRVNHFPRSYELTRKDRLYKNIE+MQH KG+K
Sbjct: 152 VAPNSSDFNLLWTGSHPKPGALRSLAPHQRVNHFPRSYELTRKDRLYKNIERMQHCKGYK 211

Query: 68  HFDFIPSTFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVA 127
           HFDFIP TFVMP +F EL  +H+R +GPWIVKPVASSRGRGI+IV+TP++VPLEE VVVA
Sbjct: 212 HFDFIPQTFVMPTEFGELCSTHHRIKGPWIVKPVASSRGRGIFIVETPNQVPLEEPVVVA 271

Query: 128 KYIEKPLLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLC 187
           KYI +PLLV GHKCDLRLYV VTS+DPL++Y+YEEGLVRFATVKYDS  K LWNPCMHLC
Sbjct: 272 KYISRPLLVAGHKCDLRLYVAVTSFDPLLVYIYEEGLVRFATVKYDSSHKQLWNPCMHLC 331

Query: 188 NYSINKHHSDYIK 200
           NYSINK+HSDY+K
Sbjct: 332 NYSINKYHSDYVK 344

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189238931|ref|XP_970924.2| PREDICTED: similar to CG31108 CG31108-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157116542|ref|XP_001658542.1| hypothetical protein AaeL_AAEL007638 [Aedes aegypti] gi|108876415|gb|EAT40640.1| AAEL007638-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170055542|ref|XP_001863628.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167875451|gb|EDS38834.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347971634|ref|XP_003436775.1| AGAP004288-PB [Anopheles gambiae str. PEST] gi|333468960|gb|EGK97133.1| AGAP004288-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347971636|ref|XP_313563.4| AGAP004288-PA [Anopheles gambiae str. PEST] gi|333468959|gb|EAA09188.4| AGAP004288-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307206995|gb|EFN84818.1| Tubulin polyglutamylase TTLL5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340714092|ref|XP_003395566.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380026047|ref|XP_003696773.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Apis florea] Back     alignment and taxonomy information
>gi|350417501|ref|XP_003491453.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
FB|FBgn0051108 917 CG31108 [Drosophila melanogast 0.916 0.203 0.689 5.7e-75
UNIPROTKB|G3V2J9 1281 TTLL5 "Tubulin polyglutamylase 0.911 0.145 0.602 3.7e-63
UNIPROTKB|Q6EMB2 1281 TTLL5 "Tubulin polyglutamylase 0.911 0.145 0.602 3.7e-63
UNIPROTKB|F6UZ25 1284 TTLL5 "Uncharacterized protein 0.911 0.144 0.602 1.9e-62
UNIPROTKB|F6UZ90 1287 TTLL5 "Uncharacterized protein 0.911 0.144 0.602 1.9e-62
MGI|MGI:2443657 1328 Ttll5 "tubulin tyrosine ligase 0.911 0.140 0.602 2.1e-62
UNIPROTKB|E1BD55 1331 TTLL5 "Uncharacterized protein 0.911 0.139 0.602 2.2e-62
UNIPROTKB|E2QU62 1333 TTLL5 "Uncharacterized protein 0.911 0.139 0.602 2.2e-62
UNIPROTKB|F1PTL6 1333 TTLL5 "Uncharacterized protein 0.911 0.139 0.602 2.2e-62
UNIPROTKB|F1NR75 1313 TTLL5 "Uncharacterized protein 0.916 0.142 0.582 2.4e-61
FB|FBgn0051108 CG31108 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 756 (271.2 bits), Expect = 5.7e-75, P = 5.7e-75
 Identities = 129/187 (68%), Positives = 162/187 (86%)

Query:    14 DFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIP 73
             +FNLLW+G+H K   +R+LAP+QRVNHFPRSYE+TRKDRLYKNIE+MQH +G KHFD +P
Sbjct:   246 NFNLLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVP 305

Query:    74 STFVMPGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKP 133
              TFV+P + R+L ++H + RGPWIVKP ASSRGRGI+IV++PD++P +E  VV+KYI  P
Sbjct:   306 QTFVLPIESRDLVVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDP 365

Query:   134 LLVEGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINK 193
             L ++GHKCDLR+YV+VTS+DPLIIY+YEEG+VR ATVKYD    +LWNPCMHLCNYSINK
Sbjct:   366 LCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDRHADNLWNPCMHLCNYSINK 425

Query:   194 HHSDYIK 200
             +HSDYI+
Sbjct:   426 YHSDYIR 432
GO:0004835 "tubulin-tyrosine ligase activity" evidence=ISS
GO:0006464 "cellular protein modification process" evidence=IEA
UNIPROTKB|G3V2J9 TTLL5 "Tubulin polyglutamylase TTLL5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6EMB2 TTLL5 "Tubulin polyglutamylase TTLL5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6UZ25 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UZ90 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2443657 Ttll5 "tubulin tyrosine ligase-like family, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BD55 TTLL5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU62 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL6 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR75 TTLL5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6EMB2TTLL5_HUMAN6, ., -, ., -, ., -0.60210.91170.1451yesN/A
Q8CHB8TTLL5_MOUSE6, ., -, ., -, ., -0.60210.91170.1400yesN/A
Q5R978TTLL5_PONAB6, ., -, ., -, ., -0.60210.91170.1431yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
pfam03133 291 pfam03133, TTL, Tubulin-tyrosine ligase family 1e-63
pfam08443190 pfam08443, RimK, RimK-like ATP-grasp domain 6e-04
>gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family Back     alignment and domain information 
 Score =  198 bits (505), Expect = 1e-63
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 7/175 (4%)

Query: 34  PHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMPGDFRELTISHYRT- 92
            HQ +NHFP SYE+TRKD L+KNI++     G K FDF+P TF++P D  E  + ++   
Sbjct: 7   YHQALNHFPGSYEITRKDLLWKNIKRQPCDFGRK-FDFLPRTFILPTDLAEF-VDYFEDN 64

Query: 93  -RGPWIVKPVASSRGRGIYIVDTPDEVPL---EESVVVAKYIEKPLLVEGHKCDLRLYVV 148
            R  WIVKP AS+RGRGI I +   ++        +VV KYIE+PLL++G K D+RLYV+
Sbjct: 65  ERNTWIVKPSASARGRGIRITNDLSQILKQIQSRPLVVQKYIERPLLIDGRKFDIRLYVL 124

Query: 149 VTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMN 203
           VTS +PL +Y+Y EGL+RFA+VKY      L +  MHL NYSI K  S   +D N
Sbjct: 125 VTSVNPLRVYVYREGLLRFASVKYSPSVSDLDDVEMHLTNYSIQKKSSSLNEDYN 179

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291
>gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG2156|consensus 662 100.0
PF03133 292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 100.0
KOG2157|consensus 497 100.0
KOG2158|consensus 565 100.0
KOG2155|consensus 631 99.97
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 99.22
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 98.0
PRK05246316 glutathione synthetase; Provisional 97.83
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 97.77
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 97.69
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 97.67
PLN02941328 inositol-tetrakisphosphate 1-kinase 97.57
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 97.46
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 97.42
PRK12458338 glutathione synthetase; Provisional 97.32
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 97.04
PRK10446300 ribosomal protein S6 modification protein; Provisi 97.04
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 97.01
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 96.62
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 96.48
PRK07206 416 hypothetical protein; Provisional 96.28
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 96.19
PRK06849 389 hypothetical protein; Provisional 96.11
PRK08462 445 biotin carboxylase; Validated 96.02
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 96.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 95.88
PRK14016 727 cyanophycin synthetase; Provisional 95.83
PRK08654 499 pyruvate carboxylase subunit A; Validated 95.72
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 95.71
TIGR02291 317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 95.61
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 95.5
PRK02186 887 argininosuccinate lyase; Provisional 95.47
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 95.35
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 95.18
PRK12999 1146 pyruvate carboxylase; Reviewed 95.17
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 95.17
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 95.04
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 94.92
PRK02471 752 bifunctional glutamate--cysteine ligase/glutathion 94.89
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 94.81
PRK07178 472 pyruvate carboxylase subunit A; Validated 94.78
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 94.73
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 94.71
PRK05586 447 biotin carboxylase; Validated 94.56
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 94.41
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 94.3
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 94.16
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 94.15
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 94.09
PRK14571299 D-alanyl-alanine synthetase A; Provisional 94.08
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 93.94
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 93.82
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 93.75
TIGR01435 737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 93.62
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 93.54
PRK14572347 D-alanyl-alanine synthetase A; Provisional 93.44
COG2308488 Uncharacterized conserved protein [Function unknow 93.3
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 93.25
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 93.24
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 92.85
PRK14569296 D-alanyl-alanine synthetase A; Provisional 92.76
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 92.66
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 92.47
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 91.99
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 91.82
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 91.35
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 90.99
PRK10507619 bifunctional glutathionylspermidine amidase/glutat 90.59
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 90.28
PHA02117397 glutathionylspermidine synthase domain-containing 88.86
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 88.12
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 88.06
PLN02257 434 phosphoribosylamine--glycine ligase 88.03
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 88.0
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 87.83
PRK14570364 D-alanyl-alanine synthetase A; Provisional 86.7
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 84.7
PLN02735 1102 carbamoyl-phosphate synthase 82.79
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 81.14
PRK06524 493 biotin carboxylase-like protein; Validated 80.68
PLN02948 577 phosphoribosylaminoimidazole carboxylase 80.41
COG0754387 Gsp Glutathionylspermidine synthase [Amino acid tr 80.27
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 80.21
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 80.03
>KOG2156|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-48  Score=344.97  Aligned_cols=200  Identities=45%  Similarity=0.739  Sum_probs=180.9

Q ss_pred             ceeccccc--cCCCCeEEEeeccCCChhHhhhcCCCcEEcccCCCccccchHHHHHHHHHHHhhcCCCCCCceeccccCh
Q psy6987           2 VFLNLGVT--SDVADFNLLWSGLHPKPQTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPSTFVMP   79 (204)
Q Consensus         2 ~~~~~~~~--~~~~~~d~~W~~~~~~~~~~~~l~~~Q~vNh~p~~~~l~~K~~l~~~l~~~~~~~~~~~~~~~P~Tf~l~   79 (204)
                      |++++|.+  ...++|..+|.... +.--++.+++||+||||||+.-|+|||.|.+++.+++...+...+.|+|+||+||
T Consensus       212 vl~~sgfkivk~n~dw~g~Wg~h~-ksp~fr~ir~HQkvNH~PGsF~IGRKD~lW~~~~~~~~rf~~kef~fmPrtyilP  290 (662)
T KOG2156|consen  212 VLANSGFKIVKVNDDWMGVWGHHL-KSPSFRAIRSHQKVNHFPGSFRIGRKDRLWRNILRNQVRFGKKEFGFMPRTYILP  290 (662)
T ss_pred             HHHhcccEEecccchHHHHhhhhc-CCchhhhhhhhhhhccCCCccccccchHHHHHHHHHHHHhcccccCccceeeecc
Confidence            56667764  57899999997654 3334689999999999999999999999999999998888878999999999999


Q ss_pred             hHHHHHHHHHhC-CCCcEEEcCCCCCCCCceEEeCCCCCCCCccceEEEecccCCcccCCcceeeEEEEEEeccCCeEEE
Q psy6987          80 GDFRELTISHYR-TRGPWIVKPVASSRGRGIYIVDTPDEVPLEESVVVAKYIEKPLLVEGHKCDLRLYVVVTSYDPLIIY  158 (204)
Q Consensus        80 ~~~~~~~~~~~~-~~~~wI~KP~~~~rG~GI~~~~~~~~i~~~~~~vvQkYI~~p~Li~grKFDiR~yvlv~s~~pl~~y  158 (204)
                      +|.+++.....+ ....||+||.+++||.||.++++..++.+..+.|||+||++|+||+|.|||+|+||+|+|.+|++||
T Consensus       291 ~d~e~lrk~w~~nasr~wIVkppasaRg~gIrv~~kw~q~pk~rpLvvQ~yieRP~ling~KFDlrlYv~vts~nPLRIy  370 (662)
T KOG2156|consen  291 ADREELRKYWEKNASRLWIVKPPASARGIGIRVINKWSQFPKDRPLVVQKYIERPLLINGSKFDLRLYVVVTSVNPLRIY  370 (662)
T ss_pred             ccHHHHHHHHhhCccccEEecCcccccCcceEeccchhhCCCcccHHHHHHhhcceeecCcceeEEEEEEEeecCceEEE
Confidence            999999876644 4667999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecccEEeecCCCCCCCCCCCCCccccccccccccCCCCCCCCCC
Q psy6987         159 MYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKDMN  203 (204)
Q Consensus       159 ~~~~g~~r~~~~~y~~~~~~~~~~~~HlTN~~vqk~~~~y~~~~~  203 (204)
                      +|++|++|||+.+|++...++.|++||+|||+++|... |..++.
T Consensus       371 ~y~dgL~RFasvkYsp~~a~~~dKymhltnYs~nke~~-ys~~k~  414 (662)
T KOG2156|consen  371 IYNDGLVRFASVKYSPFDANNVDKYMHLTNYSPNKESN-YSLNKY  414 (662)
T ss_pred             EeccceeeeccccCCcccccccceeEEeccccccccch-hhhhhH
Confidence            99999999999999998888899999999999999887 655443

>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>KOG2157|consensus Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>KOG2155|consensus Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>COG2308 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK10507 bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PHA02117 glutathionylspermidine synthase domain-containing protein Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>COG0754 Gsp Glutathionylspermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
4i4t_F 384 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 2e-09
3tig_A 380 Tubulin Tyrosine Ligase Length = 380 2e-07
>pdb|4I4T|F Chain F, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 384 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (54%), Gaps = 19/130 (14%)
Query: 81  DFRELTISHYRTR------GPWIVKPVASSRGRGIYIVDTPDEVP--LEESV---VVAKY 129
           D RE+ ++ Y  R        WI K  A ++G GI I     E+   ++E     V+ KY
Sbjct: 126 DEREVFLAAYNRRREGREGNVWIAKSSAGAKGEGILISSEASELLDFIDEQGQVHVIQKY 185
Query: 130 IEKPLLVE-GH-KCDLRLYVVVTSYDPLI-IYMYEEGLVRFATVKYDSGRKHLWNPCMHL 186
           +EKPLL+E GH K D+R +V+V   D L  IY+Y EG++R ++  Y+S   +  +   HL
Sbjct: 186 LEKPLLLEPGHRKFDIRSWVLV---DHLYNIYLYREGVLRTSSEPYNSA--NFQDKTCHL 240
Query: 187 CNYSINKHHS 196
            N+ I K +S
Sbjct: 241 TNHCIQKEYS 250
>pdb|3TIG|A Chain A, Tubulin Tyrosine Ligase Length = 380 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 2e-58
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 2e-04
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 9e-04
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380 Back     alignment and structure
 Score =  187 bits (475), Expect = 2e-58
 Identities = 51/230 (22%), Positives = 84/230 (36%), Gaps = 40/230 (17%)

Query: 8   VTSDVADFNLLWSGLHPKP--QTLRSLAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKG 65
           +  D   FNL+    +  P  +        Q VN++  + +L RK  L K I+       
Sbjct: 33  LKRDNPKFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELTE 92

Query: 66  F-----KHFDFIPSTFVMPGDFRELTISHY----------------------RTRGPWIV 98
                 + +   P+    P       +                              WI 
Sbjct: 93  TCTWFPESYVIYPTNEKTPAMRARNGLPDLANAPRTDEREEFRSSFNKKKENEEGNVWIA 152

Query: 99  KPVASSRGRGIYIVDTPDEV-----PLEESVVVAKYIEKPLLVE--GHKCDLRLYVVVTS 151
           K  + ++G GI I     E+        +  V+ KY+E PLL+E    K D+R +V+V +
Sbjct: 153 KSSSGAKGEGILISSDATELLDFIDNQGQVHVIQKYLESPLLLEPGHRKFDIRSWVLVDN 212

Query: 152 YDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKHHSDYIKD 201
                IY+Y EG++R ++  Y     +  +   HL N+ I K HS     
Sbjct: 213 --QYNIYLYREGVLRTSSEPYSD--TNFQDMTSHLTNHCIQKEHSKNYGR 258
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 100.0
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 97.66
3n6x_A474 Putative glutathionylspermidine synthase; domain o 97.29
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 97.28
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 97.23
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 97.06
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 96.99
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 96.95
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 96.92
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 96.84
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 96.7
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 96.64
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 96.56
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 96.1
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 95.97
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 95.87
3ln6_A 750 Glutathione biosynthesis bifunctional protein GSH; 95.87
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.69
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 95.67
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 95.45
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 95.43
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 95.36
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 95.34
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 95.32
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 95.32
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 95.26
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 95.24
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 95.16
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 95.15
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 95.13
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 94.98
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 94.98
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 94.94
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 94.87
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 94.81
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 94.8
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 94.79
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 94.71
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 94.7
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.63
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 94.58
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 94.51
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 94.49
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 94.49
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 94.39
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 94.37
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 94.31
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 94.3
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 94.17
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 94.05
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 93.92
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 93.91
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 93.87
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 93.73
2vob_A652 Trypanothione synthetase; ligase; 2.3A {Leishmania 93.71
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 93.7
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 93.69
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 93.68
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 93.67
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 93.63
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 93.45
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 93.41
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 93.0
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 92.18
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 92.16
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.98
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 90.6
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 89.86
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 88.57
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 88.28
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 87.8
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 86.46
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-51  Score=356.44  Aligned_cols=194  Identities=28%  Similarity=0.451  Sum_probs=132.5

Q ss_pred             ceeccc-c---ccCCCCeEEEeeccCCCh-hHhhh-cCCCcEEcccCCCccccchHHHHHHHHHHHhhcCCCCCCceecc
Q psy6987           2 VFLNLG-V---TSDVADFNLLWSGLHPKP-QTLRS-LAPHQRVNHFPRSYELTRKDRLYKNIEKMQHSKGFKHFDFIPST   75 (204)
Q Consensus         2 ~~~~~~-~---~~~~~~~d~~W~~~~~~~-~~~~~-l~~~Q~vNh~p~~~~l~~K~~l~~~l~~~~~~~~~~~~~~~P~T   75 (204)
                      ||.+.| |   +.+.++|||+|++.+..+ +.+.. ..++|+||||||+.+||||+.|+++|++++.  +...++|+|+|
T Consensus        23 vL~~~g~w~ev~~~~~~~dl~W~~~~~~p~~~l~~~p~~~Q~vNhfPg~~~l~rKd~L~~nl~~~~~--~~~~~~f~P~t  100 (380)
T 3tig_A           23 ILLASGQWKRLKRDNPKFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPE--LTETCTWFPES  100 (380)
T ss_dssp             HHHHTTSEEECCTTCSCCSEEECCSSSCCGGGSSCSTTCCCEESCCTTTHHHHSHHHHHHHHHHCHH--HHTTCTTSCCE
T ss_pred             HHHhcCCeEEeCCCCCceeEEEecCCCCCHHHhccCCCcceEEeecCCcccccccHHHHHHHHHhhh--cccccCcCCcc
Confidence            566777 4   346788999999876533 22222 2578999999999999999999999998543  45678999999


Q ss_pred             ccC-hhH-----------------------HHHHHHHHh-----CCCCcEEEcCCCCCCCCceEEeCCCCCCC-----Cc
Q psy6987          76 FVM-PGD-----------------------FRELTISHY-----RTRGPWIVKPVASSRGRGIYIVDTPDEVP-----LE  121 (204)
Q Consensus        76 f~l-~~~-----------------------~~~~~~~~~-----~~~~~wI~KP~~~~rG~GI~~~~~~~~i~-----~~  121 (204)
                      |.| |.+                       +++|+..+.     ..++.||+||.++++|+||.++++.+++.     ..
T Consensus       101 y~L~P~~~~~p~~~~~~~~~~~~~~~~~~E~~~F~~~~~~~~~~~~~~~wI~KP~~~srG~GI~l~~~~~~i~~~~~~~~  180 (380)
T 3tig_A          101 YVIYPTNEKTPAMRARNGLPDLANAPRTDEREEFRSSFNKKKENEEGNVWIAKSSSGAKGEGILISSDATELLDFIDNQG  180 (380)
T ss_dssp             EECCC------------------------CCHHHHHHHHHHHHTTCCCCEEEEESCC----CCBCCSCSHHHHHHHHHHT
T ss_pred             eeeCccccccccccccccccccccccchhHHHHHHHHHHHhhhcCCCCeEEEeCCccCCCCCEEEeCCHHHHHHHHhccC
Confidence            999 764                       345666553     35789999999999999999999998874     25


Q ss_pred             cceEEEecccCCccc--CCcceeeEEEEEEeccCCeEEEEecccEEeecCCCCCCCCCCCCCccccccccccccC-CCCC
Q psy6987         122 ESVVVAKYIEKPLLV--EGHKCDLRLYVVVTSYDPLIIYMYEEGLVRFATVKYDSGRKHLWNPCMHLCNYSINKH-HSDY  198 (204)
Q Consensus       122 ~~~vvQkYI~~p~Li--~grKFDiR~yvlv~s~~pl~~y~~~~g~~r~~~~~y~~~~~~~~~~~~HlTN~~vqk~-~~~y  198 (204)
                      ..+|||+||++|+||  +|||||||+||||+|  |+++|+|++|++|+|+++|+.+  ++.+.++||||+||||+ +++|
T Consensus       181 ~~~VvQkYI~~PlLi~~~grKFDlR~Yvlvts--~l~vy~y~~g~~Rfa~~~y~~~--~~~~~~~HLTN~~iqk~~~~~y  256 (380)
T 3tig_A          181 QVHVIQKYLESPLLLEPGHRKFDIRSWVLVDN--QYNIYLYREGVLRTSSEPYSDT--NFQDMTSHLTNHCIQKEHSKNY  256 (380)
T ss_dssp             SCEEEEECCSSBCCBTTTTBCEEEEEEEEECT--TCCEEECSCCEEEECC------------------------------
T ss_pred             CcEEEEecccCceeecCCCceeEEEEEEEEcC--CCEEEEEcCCEEEecCCCcCcc--chhhhhhhcccccccccccccc
Confidence            789999999999999  999999999999999  9999999999999999999975  46688999999999997 4577


Q ss_pred             CCC
Q psy6987         199 IKD  201 (204)
Q Consensus       199 ~~~  201 (204)
                      ++.
T Consensus       257 ~~~  259 (380)
T 3tig_A          257 GRY  259 (380)
T ss_dssp             ---
T ss_pred             ccc
Confidence            653
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 97.94
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 97.5
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 97.29
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 96.31
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 95.67
d2io8a3297 Glutathionylspermidine synthase, synthetase domain 95.31
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 94.8
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 93.9
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 93.8
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 93.51
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 92.06
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 91.45
d1a9xa6 259 Carbamoyl phosphate synthetase (CPS), large subuni 91.41
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 91.17
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 89.91
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 89.5
d1a9xa5 275 Carbamoyl phosphate synthetase (CPS), large subuni 89.38
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: ATP-binding domain of peptide synthetases
domain: Prokaryotic glutathione synthetase, C-domain
species: Escherichia coli [TaxId: 562]

Probab=97.94  E-value=1.3e-05  Score=61.31  Aligned_cols=73  Identities=23%  Similarity=0.323  Sum_probs=56.3

Q ss_pred             CCceeccccC--hhHHHHHHHHHhCCCCcEEEcCCCCCCCCceEEeCCCCCC----------CCccceEEEecccCCccc
Q psy6987          69 FDFIPSTFVM--PGDFRELTISHYRTRGPWIVKPVASSRGRGIYIVDTPDEV----------PLEESVVVAKYIEKPLLV  136 (204)
Q Consensus        69 ~~~~P~Tf~l--~~~~~~~~~~~~~~~~~wI~KP~~~~rG~GI~~~~~~~~i----------~~~~~~vvQkYI~~p~Li  136 (204)
                      .++.|+|.+.  +.++++|...+    +.+|+||..|+.|+|+..+...+..          ......++|+|++..   
T Consensus        10 ~~~~P~Tlit~~~~~~~~f~~~~----g~vV~Kpl~gs~G~gv~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~---   82 (192)
T d1gsaa2          10 SDLTPETLVTRNKAQLKAFWEKH----SDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAI---   82 (192)
T ss_dssp             TTTSCCEEEESCHHHHHHHHHHH----SSEEEECSSCCTTTTCEEECTTCTTHHHHHHHHTTTTTSCEEEEECCGGG---
T ss_pred             cccCCCeEEECCHHHHHHHHHHc----CCeEEEEcCCCeEEEEEEeecCchhhhHHHHHHHhcCccccccccccccc---
Confidence            4679999887  56777887765    5899999999999999999865442          235567889998733   


Q ss_pred             CCcceeeEEEEEEe
Q psy6987         137 EGHKCDLRLYVVVT  150 (204)
Q Consensus       137 ~grKFDiR~yvlv~  150 (204)
                        .+.|+|++|+-.
T Consensus        83 --~~~d~Rv~vv~~   94 (192)
T d1gsaa2          83 --KDGDKRVLVVDG   94 (192)
T ss_dssp             --GGCEEEEEEETT
T ss_pred             --cCceeEEEEECC
Confidence              457999998853
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d2io8a3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure