Psyllid ID: psy700


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGEGKEEEEEKEEEGEEEDNEKEEKEKKEEEEEEEEEEKN
ccccccccccccccccccEEEEccccEEEcccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHc
cccHHcccEEEcccccccEEEEcccEEEEEcccHEEHHHHHccccccccccccccccccHHHcccccccHHcccHHHHHccHHHHHHHccccc
mgylhargilhkdlksknifieknnkvvITDFGLFNFSKLynsytsnekpssplgegkeeeeekeeegeeednekEEKEKKEEEEEEEEEEKN
mgylhargilhkdlksknifiekNNKVVITDFGLFNFSKLYNsytsnekpssplgegkeeeeekeeegeeednekeekekkeeeeeeeeeekn
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLgegkeeeeekeeegeeednekeekekkeeeeeeeeeekN
***LHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSY*************************************************
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFS*******************************************************
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSY*************************************************
*GYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYN***************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q6VAB6950 Kinase suppressor of Ras yes N/A 0.451 0.044 0.697 8e-12
Q3UVC0959 Kinase suppressor of Ras yes N/A 0.451 0.043 0.697 9e-12
Q61097 873 Kinase suppressor of Ras no N/A 0.397 0.042 0.763 3e-11
Q8IVT5 921 Kinase suppressor of Ras no N/A 0.397 0.040 0.763 3e-11
Q21017 822 Serine/threonine-protein no N/A 0.569 0.064 0.392 3e-07
A8WRV1 813 Serine/threonine-protein N/A N/A 0.569 0.065 0.375 2e-06
Q9HFF4 1023 Serine/threonine-protein yes N/A 0.365 0.033 0.5 3e-06
P10398606 Serine/threonine-protein no N/A 0.548 0.084 0.450 8e-06
O19004606 Serine/threonine-protein no N/A 0.548 0.084 0.450 8e-06
Q03002 865 Fatty acyl-CoA synthetase yes N/A 0.365 0.039 0.5 8e-06
>sp|Q6VAB6|KSR2_HUMAN Kinase suppressor of Ras 2 OS=Homo sapiens GN=KSR2 PE=1 SV=2 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 36/43 (83%), Gaps = 1/43 (2%)

Query: 1   MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNS 43
           MGYLHA+GILHKDLKSKN+F + N KVVITDFGLF+ S +  +
Sbjct: 774 MGYLHAKGILHKDLKSKNVFYD-NGKVVITDFGLFSISGVLQA 815




Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.
Homo sapiens (taxid: 9606)
>sp|Q3UVC0|KSR2_MOUSE Kinase suppressor of Ras 2 OS=Mus musculus GN=Ksr2 PE=2 SV=2 Back     alignment and function description
>sp|Q61097|KSR1_MOUSE Kinase suppressor of Ras 1 OS=Mus musculus GN=Ksr1 PE=1 SV=1 Back     alignment and function description
>sp|Q8IVT5|KSR1_HUMAN Kinase suppressor of Ras 1 OS=Homo sapiens GN=KSR1 PE=1 SV=2 Back     alignment and function description
>sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 Back     alignment and function description
>sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 Back     alignment and function description
>sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 Back     alignment and function description
>sp|P10398|ARAF_HUMAN Serine/threonine-protein kinase A-Raf OS=Homo sapiens GN=ARAF PE=1 SV=2 Back     alignment and function description
>sp|O19004|ARAF_PIG Serine/threonine-protein kinase A-Raf OS=Sus scrofa GN=ARAF PE=2 SV=1 Back     alignment and function description
>sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
383861184 900 PREDICTED: kinase suppressor of Ras 1-li 0.559 0.057 0.685 2e-12
443714848 536 hypothetical protein CAPTEDRAFT_228240 [ 0.580 0.100 0.690 2e-12
156548452 897 PREDICTED: kinase suppressor of Ras 1-li 0.494 0.051 0.75 3e-12
189239951 874 PREDICTED: similar to kinase suppressor 0.580 0.061 0.672 3e-12
345485975 920 PREDICTED: kinase suppressor of Ras 1-li 0.494 0.05 0.75 3e-12
321458366 927 hypothetical protein DAPPUDRAFT_329047 [ 0.419 0.042 0.825 4e-12
340711827 913 PREDICTED: kinase suppressor of Ras 2-li 0.419 0.042 0.825 5e-12
350402744 913 PREDICTED: kinase suppressor of Ras 2-li 0.419 0.042 0.825 5e-12
307169064 901 Kinase suppressor of Ras 2 [Camponotus f 0.419 0.043 0.825 5e-12
391340414 813 PREDICTED: kinase suppressor of Ras 1-li 0.419 0.047 0.825 2e-11
>gi|383861184|ref|XP_003706066.1| PREDICTED: kinase suppressor of Ras 1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 42/54 (77%), Gaps = 2/54 (3%)

Query: 1   MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKL-YNSYTSNEKPSSP 53
           MGYLHARGI+HKDLKSKNIF+E N KVVITDFGLF+ +KL Y + T N     P
Sbjct: 718 MGYLHARGIIHKDLKSKNIFLE-NGKVVITDFGLFSVTKLCYGNRTGNALSIPP 770




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|443714848|gb|ELU07085.1| hypothetical protein CAPTEDRAFT_228240 [Capitella teleta] Back     alignment and taxonomy information
>gi|156548452|ref|XP_001605076.1| PREDICTED: kinase suppressor of Ras 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|189239951|ref|XP_001812757.1| PREDICTED: similar to kinase suppressor of ras CG2899-PA [Tribolium castaneum] gi|270011828|gb|EFA08276.1| hypothetical protein TcasGA2_TC005910 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345485975|ref|XP_003425378.1| PREDICTED: kinase suppressor of Ras 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321458366|gb|EFX69435.1| hypothetical protein DAPPUDRAFT_329047 [Daphnia pulex] Back     alignment and taxonomy information
>gi|340711827|ref|XP_003394470.1| PREDICTED: kinase suppressor of Ras 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350402744|ref|XP_003486588.1| PREDICTED: kinase suppressor of Ras 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307169064|gb|EFN61908.1| Kinase suppressor of Ras 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|391340414|ref|XP_003744536.1| PREDICTED: kinase suppressor of Ras 1-like [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
UNIPROTKB|F1RKG1804 KSR2 "Uncharacterized protein" 0.516 0.059 0.632 3e-10
RGD|1562674899 Ksr2 "kinase suppressor of ras 0.516 0.053 0.632 3.5e-10
UNIPROTKB|F1MF36949 KSR2 "Uncharacterized protein" 0.516 0.050 0.632 3.8e-10
MGI|MGI:3610315959 Ksr2 "kinase suppressor of ras 0.516 0.050 0.632 3.8e-10
UNIPROTKB|F1NCU3754 F1NCU3 "Uncharacterized protei 0.397 0.049 0.789 4.5e-10
UNIPROTKB|E9PB13921 KSR2 "Kinase suppressor of Ras 0.516 0.052 0.632 4.6e-10
UNIPROTKB|F1P721949 KSR2 "Uncharacterized protein" 0.516 0.050 0.632 4.8e-10
UNIPROTKB|Q6VAB6950 KSR2 "Kinase suppressor of Ras 0.516 0.050 0.632 4.8e-10
UNIPROTKB|E1BFS2 848 Bt.26557 "Uncharacterized prot 0.397 0.043 0.763 5.7e-10
UNIPROTKB|F1RJ53 849 KSR1 "Uncharacterized protein" 0.397 0.043 0.763 5.7e-10
UNIPROTKB|F1RKG1 KSR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 3.0e-10, P = 3.0e-10
 Identities = 31/49 (63%), Positives = 39/49 (79%)

Query:     1 MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEK 49
             MGYLHA+GILHKDLKSKN+F + N KVVITDFGLF+ S +  +   ++K
Sbjct:   628 MGYLHAKGILHKDLKSKNVFYD-NGKVVITDFGLFSISGVLQAGRRDDK 675




GO:0043410 "positive regulation of MAPK cascade" evidence=IEA
GO:0031434 "mitogen-activated protein kinase kinase binding" evidence=IEA
GO:0019722 "calcium-mediated signaling" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0005078 "MAP-kinase scaffold activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
RGD|1562674 Ksr2 "kinase suppressor of ras 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF36 KSR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:3610315 Ksr2 "kinase suppressor of ras 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCU3 F1NCU3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PB13 KSR2 "Kinase suppressor of Ras 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P721 KSR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VAB6 KSR2 "Kinase suppressor of Ras 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFS2 Bt.26557 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ53 KSR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3UVC0KSR2_MOUSENo assigned EC number0.69760.45160.0437yesN/A
Q6VAB6KSR2_HUMANNo assigned EC number0.69760.45160.0442yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-11
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-11
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 6e-10
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-09
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 9e-09
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-08
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-08
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-08
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-08
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-08
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-08
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-08
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 7e-08
PHA03207 392 PHA03207, PHA03207, serine/threonine kinase US3; P 9e-08
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-07
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-07
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 5e-07
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 6e-07
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-07
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-06
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-06
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-06
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-06
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-06
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-06
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-06
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-06
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-06
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-06
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-06
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 3e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-06
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-06
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 3e-06
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-06
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 4e-06
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-06
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 4e-06
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-06
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-06
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 6e-06
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 6e-06
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 7e-06
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 7e-06
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 8e-06
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 8e-06
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 9e-06
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 1e-05
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 1e-05
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-05
PHA03212 391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 2e-05
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-05
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-05
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-05
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-05
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 3e-05
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 3e-05
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 3e-05
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 3e-05
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 3e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 4e-05
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-05
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-05
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 4e-05
pfam03344 715 pfam03344, Daxx, Daxx Family 4e-05
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 4e-05
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 4e-05
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 4e-05
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 5e-05
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 5e-05
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 5e-05
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 5e-05
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 5e-05
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 5e-05
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 6e-05
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 6e-05
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 6e-05
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 6e-05
PTZ00024 335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 7e-05
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 7e-05
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 7e-05
PRK01723239 PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-ac 7e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 8e-05
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 8e-05
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 8e-05
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 9e-05
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-05
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 9e-05
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 9e-05
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-04
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 1e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 1e-04
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-04
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 1e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-04
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-04
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 1e-04
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-04
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 2e-04
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-04
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-04
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 2e-04
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-04
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 2e-04
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-04
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-04
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 3e-04
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 3e-04
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 3e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-04
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 3e-04
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-04
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-04
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 4e-04
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 4e-04
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 4e-04
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 4e-04
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 4e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 5e-04
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 5e-04
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 5e-04
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 5e-04
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 5e-04
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 5e-04
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-04
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 5e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 6e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 6e-04
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 6e-04
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 6e-04
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-04
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-04
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 6e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 6e-04
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 6e-04
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 7e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 7e-04
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 8e-04
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 8e-04
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 8e-04
cd07880 343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 8e-04
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 9e-04
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 9e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 9e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 0.001
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 0.001
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 0.001
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.001
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 0.001
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.001
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 0.001
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 0.001
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 0.001
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 0.001
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.001
PHA03210 501 PHA03210, PHA03210, serine/threonine kinase US3; P 0.001
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 0.001
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 0.001
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 0.002
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 0.002
PRK09605535 PRK09605, PRK09605, bifunctional UGMP family prote 0.002
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 0.002
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 0.002
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 0.002
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 0.002
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 0.002
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 0.002
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 0.002
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 0.002
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 0.002
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 0.002
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
cd07868 317 cd07868, STKc_CDK8, Catalytic domain of the Serine 0.003
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 0.003
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.003
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.003
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 0.003
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 0.003
PHA02882294 PHA02882, PHA02882, putative serine/threonine kina 0.003
cd07867 317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 0.003
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 0.003
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 0.003
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.003
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 0.003
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 0.003
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 0.003
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 0.003
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.004
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 0.004
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 0.004
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 0.004
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.004
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 0.004
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.004
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.004
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
 Score = 56.5 bits (137), Expect = 4e-11
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 3   YLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLG 55
           YLH+ GI+H+DLK +NI +++N  V I DFGL   +K      S+   ++ +G
Sbjct: 113 YLHSNGIIHRDLKPENILLDENGVVKIADFGL---AKKL--LKSSSSLTTFVG 160


Length = 260

>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|234975 PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|236586 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0600|consensus 560 99.18
KOG0594|consensus323 99.15
KOG0593|consensus 396 99.08
KOG0595|consensus 429 99.07
KOG0598|consensus 357 99.06
KOG0581|consensus364 99.05
KOG0583|consensus 370 99.05
KOG0615|consensus475 99.05
KOG0659|consensus 318 99.03
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.02
KOG0198|consensus313 99.01
KOG0192|consensus 362 99.0
KOG0660|consensus 359 99.0
KOG0193|consensus678 98.97
KOG0585|consensus 576 98.96
KOG0578|consensus550 98.95
KOG0592|consensus 604 98.94
PTZ00283 496 serine/threonine protein kinase; Provisional 98.91
KOG0197|consensus468 98.9
KOG0661|consensus 538 98.9
KOG0663|consensus 419 98.89
PHA02882294 putative serine/threonine kinase; Provisional 98.89
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 98.89
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.89
KOG0575|consensus 592 98.89
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.88
PTZ00267 478 NIMA-related protein kinase; Provisional 98.88
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.88
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 98.87
KOG0599|consensus 411 98.87
PHA03212 391 serine/threonine kinase US3; Provisional 98.87
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.86
KOG0591|consensus 375 98.85
PHA03210 501 serine/threonine kinase US3; Provisional 98.85
KOG0662|consensus292 98.85
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.85
PHA03207 392 serine/threonine kinase US3; Provisional 98.85
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.85
PHA03211461 serine/threonine kinase US3; Provisional 98.85
KOG0658|consensus 364 98.84
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.84
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 98.83
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 98.83
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.83
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 98.82
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 98.82
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.82
KOG1187|consensus361 98.81
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.81
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 98.81
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.8
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.8
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.79
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.79
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.79
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 98.78
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.78
KOG0616|consensus 355 98.78
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.78
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.78
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.78
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 98.77
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.77
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.77
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.76
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 98.76
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.76
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.75
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.75
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.75
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 98.75
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.75
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.75
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.75
KOG0614|consensus 732 98.75
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 98.74
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.74
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.74
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.74
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.74
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 98.74
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.73
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.73
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 98.73
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 98.73
KOG0669|consensus 376 98.73
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.73
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.73
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.73
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 98.72
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.72
KOG0694|consensus 694 98.72
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 98.72
KOG0582|consensus 516 98.72
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 98.72
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.71
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.71
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.71
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.71
KOG0597|consensus 808 98.71
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.71
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.71
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.7
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.7
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.7
PRK09188 365 serine/threonine protein kinase; Provisional 98.7
KOG0577|consensus 948 98.7
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.7
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 98.7
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.7
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.69
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 98.69
KOG0596|consensus 677 98.69
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 98.69
PTZ00263 329 protein kinase A catalytic subunit; Provisional 98.69
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 98.68
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.68
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 98.68
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.68
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.68
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 98.68
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.67
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.67
PLN00034353 mitogen-activated protein kinase kinase; Provision 98.67
KOG1035|consensus 1351 98.67
KOG0984|consensus282 98.67
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.66
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.66
PHA03209357 serine/threonine kinase US3; Provisional 98.66
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 98.66
KOG0201|consensus 467 98.66
KOG0611|consensus 668 98.66
KOG0983|consensus391 98.66
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.66
PTZ00036 440 glycogen synthase kinase; Provisional 98.65
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.65
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 98.65
KOG0033|consensus 355 98.65
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.65
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 98.65
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.65
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 98.64
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 98.63
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 98.63
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.63
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.63
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.63
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.62
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.62
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 98.62
KOG0664|consensus 449 98.62
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 98.62
KOG0579|consensus 1187 98.62
KOG0587|consensus 953 98.62
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 98.61
KOG0666|consensus 438 98.61
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 98.61
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.6
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.59
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.59
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.58
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 98.58
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.57
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.57
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.57
KOG0612|consensus 1317 98.57
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.56
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 98.56
PLN03224507 probable serine/threonine protein kinase; Provisio 98.56
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 98.56
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.55
KOG0588|consensus 786 98.55
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.55
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.55
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.54
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.54
KOG1026|consensus774 98.54
KOG0194|consensus 474 98.54
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 98.54
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.54
KOG0986|consensus 591 98.54
KOG4721|consensus 904 98.53
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 98.53
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.53
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.53
KOG0604|consensus 400 98.53
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.53
KOG0584|consensus 632 98.53
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.53
KOG0589|consensus 426 98.52
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 98.52
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 98.52
KOG1095|consensus 1025 98.52
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 98.52
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.52
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.51
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.51
KOG0586|consensus 596 98.5
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 98.5
KOG0580|consensus281 98.5
KOG0032|consensus 382 98.5
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.5
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.5
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.5
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.49
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.49
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.49
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 98.49
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.49
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.49
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.49
KOG0605|consensus 550 98.49
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 98.48
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.48
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.48
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.48
PTZ00284 467 protein kinase; Provisional 98.48
KOG4257|consensus 974 98.48
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.48
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 98.48
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 98.48
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.48
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.48
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 98.48
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.47
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.47
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.47
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.47
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.47
KOG1027|consensus 903 98.47
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 98.46
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.45
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.45
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 98.45
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 98.45
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.45
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.45
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.45
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.45
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.45
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 98.44
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.44
PLN00181 793 protein SPA1-RELATED; Provisional 98.44
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.43
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.43
KOG1152|consensus772 98.43
KOG0665|consensus 369 98.43
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 98.42
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 98.42
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.42
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.42
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.41
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.41
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.41
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.41
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.4
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.4
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.4
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 98.4
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.4
KOG0603|consensus612 98.4
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.4
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.4
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.39
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.39
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 98.39
KOG4645|consensus1509 98.39
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.39
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.39
KOG0667|consensus 586 98.39
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 98.38
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.38
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 98.38
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 98.38
KOG4236|consensus 888 98.38
PRK12274218 serine/threonine protein kinase; Provisional 98.38
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.37
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.37
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.37
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.37
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.37
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.37
KOG0690|consensus 516 98.37
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.36
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.36
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.36
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 98.35
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.35
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.35
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.35
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.35
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.35
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.35
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 98.35
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 98.35
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.35
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.34
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.34
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.34
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 98.34
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.34
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.33
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.33
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.33
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.33
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.33
KOG1006|consensus361 98.33
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 98.33
PLN00009294 cyclin-dependent kinase A; Provisional 98.32
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.32
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.32
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.32
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.32
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.32
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 98.32
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.32
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.31
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.31
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.31
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.3
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.3
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.3
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 98.3
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.29
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.29
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.29
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 98.29
KOG0696|consensus 683 98.28
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 98.28
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.28
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 98.28
KOG0574|consensus 502 98.27
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.27
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.27
KOG1094|consensus807 98.26
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.26
KOG0200|consensus609 98.26
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.26
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.26
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.26
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.25
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.25
KOG3653|consensus 534 98.25
KOG4250|consensus 732 98.25
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.24
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 98.24
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.24
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.24
KOG0668|consensus338 98.23
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.23
KOG1164|consensus322 98.23
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.23
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 98.22
PHA02988283 hypothetical protein; Provisional 98.22
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.22
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 98.22
KOG0196|consensus 996 98.22
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.22
KOG0608|consensus 1034 98.21
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.21
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 98.21
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.21
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 98.21
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.2
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 98.2
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.2
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 98.19
KOG1989|consensus 738 98.18
KOG1345|consensus 378 98.18
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.18
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.18
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.18
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.18
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.17
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 98.17
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.16
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.13
KOG4278|consensus 1157 98.12
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.11
KOG0695|consensus 593 98.11
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.11
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.1
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.09
KOG4717|consensus 864 98.09
KOG4279|consensus 1226 98.08
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.07
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 98.05
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 98.05
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.04
smart00090237 RIO RIO-like kinase. 98.02
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 97.99
COG0515 384 SPS1 Serine/threonine protein kinase [General func 97.99
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 97.98
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 97.98
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 97.98
PTZ00266 1021 NIMA-related protein kinase; Provisional 97.97
PRK14879211 serine/threonine protein kinase; Provisional 97.92
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 97.9
KOG0576|consensus 829 97.89
PRK10345210 hypothetical protein; Provisional 97.89
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 97.88
KOG0590|consensus601 97.87
PRK09605535 bifunctional UGMP family protein/serine/threonine 97.85
KOG1163|consensus 341 97.85
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 97.84
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 97.84
KOG1151|consensus775 97.83
KOG1167|consensus 418 97.8
KOG0610|consensus 459 97.8
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 97.77
KOG0607|consensus 463 97.76
KOG0199|consensus 1039 97.75
KOG2052|consensus513 97.66
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 97.64
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 97.58
KOG0670|consensus 752 97.58
KOG0671|consensus415 97.49
KOG1165|consensus 449 97.49
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 97.42
KOG2345|consensus302 97.37
KOG1025|consensus 1177 97.28
KOG1024|consensus563 97.24
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.23
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.21
KOG0606|consensus 1205 97.03
KOG1166|consensus974 97.02
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 96.9
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 96.88
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 96.8
KOG3087|consensus229 96.77
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 96.65
KOG4158|consensus 598 96.61
PLN00113968 leucine-rich repeat receptor-like protein kinase; 96.56
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 96.48
KOG1033|consensus516 96.47
KOG0590|consensus 601 96.25
KOG1240|consensus 1431 96.05
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 95.99
KOG0603|consensus 612 95.56
KOG1023|consensus 484 94.85
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 93.92
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 93.59
PRK05231319 homoserine kinase; Provisional 93.34
PRK09902216 hypothetical protein; Provisional 93.21
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 93.13
PF01636239 APH: Phosphotransferase enzyme family This family 92.99
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 92.59
KOG1290|consensus 590 92.05
KOG0601|consensus 524 91.66
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 91.32
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 91.26
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 91.01
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 90.98
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 90.74
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 89.71
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 89.64
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 89.21
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 88.84
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 88.83
COG0478304 RIO-like serine/threonine protein kinase fused to 88.74
PRK10271188 thiK thiamine kinase; Provisional 87.64
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 85.73
KOG2137|consensus 700 85.28
PLN02236344 choline kinase 85.14
COG0661 517 AarF Predicted unusual protein kinase [General fun 84.63
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 83.41
COG2334331 Putative homoserine kinase type II (protein kinase 83.03
KOG0601|consensus524 82.75
>KOG0600|consensus Back     alignment and domain information
Probab=99.18  E-value=8.9e-12  Score=93.42  Aligned_cols=63  Identities=33%  Similarity=0.452  Sum_probs=49.7

Q ss_pred             CccchhCCccccCCCCCceEEecCCcEEEeeccccccccccCCCCCCCCCCCCCCCChhhhhhh
Q psy700            1 MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGEGKEEEEEK   64 (93)
Q Consensus         1 l~~lhs~~iihrdlk~~nill~~~~~~kl~dfgla~~~~~~~~~~~~~~~~~~~~~~p~e~~~~   64 (93)
                      |.|||.++|+||||+..|||++.++.+||+|||||++........-+. ...+.||.|||-...
T Consensus       231 l~~cH~~gvlHRDIK~SNiLidn~G~LKiaDFGLAr~y~~~~~~~~T~-rVvTLWYRpPELLLG  293 (560)
T KOG0600|consen  231 LEYCHSRGVLHRDIKGSNILIDNNGVLKIADFGLARFYTPSGSAPYTS-RVVTLWYRPPELLLG  293 (560)
T ss_pred             HHHHhhcCeeeccccccceEEcCCCCEEeccccceeeccCCCCccccc-ceEEeeccChHHhcC
Confidence            579999999999999999999999999999999998766444332222 234678888886544



>KOG0594|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 1e-11
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-07
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-07
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-07
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-06
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 4e-06
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 4e-06
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-06
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 4e-06
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 4e-06
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 4e-06
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 5e-06
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-05
4h58_A275 Braf In Complex With Compound 3 Length = 275 1e-05
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 1e-05
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 1e-05
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-05
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-05
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 2e-05
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 4e-05
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 6e-05
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 7e-05
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 7e-05
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 7e-05
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 7e-05
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 7e-05
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 7e-05
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 7e-05
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 7e-05
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 7e-05
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 7e-05
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 7e-05
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 8e-05
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 8e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 8e-05
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 9e-05
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 9e-05
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-04
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 1e-04
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 1e-04
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 1e-04
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 1e-04
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 1e-04
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 1e-04
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 1e-04
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-04
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-04
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-04
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 2e-04
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 2e-04
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-04
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-04
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-04
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-04
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 3e-04
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-04
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 3e-04
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-04
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 3e-04
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 3e-04
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 3e-04
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 3e-04
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 3e-04
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 3e-04
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 3e-04
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 3e-04
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 3e-04
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 4e-04
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 4e-04
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 4e-04
3lxk_A327 Structural And Thermodynamic Characterization Of Th 4e-04
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 4e-04
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 4e-04
3lxn_A318 Structural And Thermodynamic Characterization Of Th 4e-04
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 5e-04
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 5e-04
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 5e-04
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 5e-04
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 5e-04
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 5e-04
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 5e-04
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 5e-04
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 5e-04
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 5e-04
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 5e-04
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 6e-04
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 6e-04
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 6e-04
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 8e-04
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 8e-04
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 8e-04
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 8e-04
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 8e-04
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 8e-04
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 8e-04
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 8e-04
4fie_A423 Full-Length Human Pak4 Length = 423 8e-04
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 8e-04
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 8e-04
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 8e-04
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 8e-04
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 8e-04
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 1e-11, Method: Composition-based stats. Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query: 1 MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEK 49 MGYLHA+GILHKDLKSKN+F + N KVVITDFGLF+ S + + +K Sbjct: 143 MGYLHAKGILHKDLKSKNVFYD-NGKVVITDFGLFSISGVLQAGRREDK 190
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.43
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.4
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.36
4aoj_A329 High affinity nerve growth factor receptor; transf 99.36
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.34
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.34
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.32
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.3
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.3
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.29
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.29
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.27
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.26
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.24
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.22
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.22
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.15
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.14
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.12
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.12
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.11
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.04
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.03
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.03
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.0
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.0
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 98.99
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 98.99
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 98.98
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 98.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 98.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 98.97
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 98.96
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 98.96
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 98.95
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.95
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.95
3soc_A322 Activin receptor type-2A; structural genomics cons 98.95
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 98.95
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 98.95
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 98.95
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 98.95
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 98.94
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.94
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 98.94
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 98.94
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 98.93
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 98.92
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 98.92
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.92
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.92
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 98.91
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 98.91
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 98.91
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.91
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 98.9
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 98.9
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 98.9
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 98.9
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 98.9
2xir_A316 Vascular endothelial growth factor receptor 2; ang 98.9
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 98.9
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 98.89
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.89
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.89
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.89
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 98.89
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 98.89
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 98.89
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 98.89
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 98.89
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 98.89
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 98.89
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.88
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 98.88
3o0g_A292 Cell division protein kinase 5; kinase activator c 98.88
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 98.88
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 98.88
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 98.87
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 98.87
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 98.87
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 98.87
3niz_A311 Rhodanese family protein; structural genomics, str 98.86
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 98.86
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.86
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.86
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 98.86
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 98.85
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.85
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.85
3q4u_A301 Activin receptor type-1; structural genomics conso 98.85
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.85
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 98.85
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.85
3pls_A298 Macrophage-stimulating protein receptor; protein k 98.85
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 98.84
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 98.84
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 98.84
3ork_A311 Serine/threonine protein kinase; structural genomi 98.84
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 98.83
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 98.83
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 98.83
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 98.83
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.83
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.83
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.83
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 98.82
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 98.82
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 98.82
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.82
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 98.82
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 98.82
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.82
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.81
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 98.81
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 98.8
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 98.8
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 98.8
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.79
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 98.79
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.79
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.79
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 98.79
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.79
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 98.79
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.78
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 98.78
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.78
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.78
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 98.78
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 98.78
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 98.77
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 98.77
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 98.77
2eue_A275 Carbon catabolite derepressing protein kinase; kin 98.77
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.77
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.77
2a19_B284 Interferon-induced, double-stranded RNA-activated 98.77
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 98.77
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 98.76
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.76
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.76
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.76
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.75
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 98.75
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.75
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 98.75
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 98.75
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 98.75
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 98.74
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 98.74
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 98.74
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.74
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.73
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.73
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.73
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 98.73
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 98.73
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 98.73
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 98.73
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 98.73
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 98.73
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.73
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 98.73
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 98.72
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 98.72
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.72
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.72
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 98.72
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 98.72
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 98.72
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 98.72
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.71
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.71
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 98.71
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 98.71
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.71
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 98.71
3fme_A290 Dual specificity mitogen-activated protein kinase; 98.71
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 98.71
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 98.71
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 98.7
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 98.7
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.7
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 98.7
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.69
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.69
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.69
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 98.69
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 98.69
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 98.69
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 98.69
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.69
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 98.69
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.69
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 98.68
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 98.68
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.68
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 98.67
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.67
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 98.67
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.67
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 98.67
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 98.66
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 98.66
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 98.66
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.65
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.65
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 98.65
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 98.64
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 98.64
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.64
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 98.64
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.64
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 98.64
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 98.63
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 98.63
3an0_A340 Dual specificity mitogen-activated protein kinase; 98.63
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 98.63
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 98.62
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 98.62
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 98.62
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 98.62
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 98.62
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 98.62
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 98.61
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 98.61
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.61
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.6
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 98.6
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 98.59
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 98.59
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 98.58
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 98.57
3aln_A327 Dual specificity mitogen-activated protein kinase; 98.57
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.57
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 98.57
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.56
2dyl_A318 Dual specificity mitogen-activated protein kinase 98.55
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 98.54
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 98.54
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.53
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.53
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 98.52
3bhy_A283 Death-associated protein kinase 3; death associate 98.52
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 98.45
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.39
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.39
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 98.37
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.34
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 98.33
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 98.33
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 98.26
3uqc_A286 Probable conserved transmembrane protein; structur 97.82
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.37
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 96.0
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 94.61
2q83_A346 YTAA protein; 2635576, structural genomics, joint 93.82
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 93.25
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 93.1
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 92.46
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 91.86
3r70_A320 Aminoglycoside phosphotransferase; structural geno 91.19
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 91.14
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 90.37
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 90.32
3ats_A357 Putative uncharacterized protein; hypothetical pro 90.3
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 90.21
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 87.78
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 86.4
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 84.54
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 83.88
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 82.96
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 81.17
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
Probab=99.43  E-value=4.6e-14  Score=99.49  Aligned_cols=62  Identities=35%  Similarity=0.544  Sum_probs=42.0

Q ss_pred             CccchhCCccccCCCCCceEEecCCcEEEeeccccccccccCCCCCCCCCCCCCCCChhhhh
Q psy700            1 MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGEGKEEEE   62 (93)
Q Consensus         1 l~~lhs~~iihrdlk~~nill~~~~~~kl~dfgla~~~~~~~~~~~~~~~~~~~~~~p~e~~   62 (93)
                      |.|||+++|+||||+|.|||++.++.+||+|||+|+...............++.+|++||.-
T Consensus       145 L~yLH~~~IiHRDlKp~NILl~~~~~~Ki~DFGla~~~~~~~~~~~~~~~~GT~~ymAPE~l  206 (307)
T 3omv_A          145 MDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVI  206 (307)
T ss_dssp             HHHHHHTTCBCSCCCSSSEEEETTEEEEECCCSSCBC------------CCCCTTSCCHHHH
T ss_pred             HHHHHHCCccCCccCHHHEEECCCCcEEEeeccCceecccCCcceeecccccCCCccCHHHh
Confidence            47999999999999999999999999999999999876544333333334455556555543



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-09
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-08
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-08
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-08
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-08
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-07
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-07
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-07
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-07
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-07
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-07
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-07
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-07
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 7e-07
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-07
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 8e-07
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 9e-07
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-06
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-06
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-06
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-06
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-06
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 5e-06
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 5e-06
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-06
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 9e-06
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-05
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-05
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-05
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-05
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-05
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-05
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-05
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-05
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-05
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-05
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-05
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-05
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-04
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-04
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-04
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-04
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-04
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-04
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-04
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-04
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 8e-04
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 8e-04
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-04
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.001
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 0.002
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 0.003
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 0.003
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 0.004
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.2 bits (117), Expect = 4e-09
 Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 1   MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLG 55
           M YLHA+ I+H+DLKS NIF+ ++  V I DFGL   + + + ++ + +     G
Sbjct: 117 MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGL---ATVKSRWSGSHQFEQLSG 168


>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.36
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.33
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.29
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.24
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.24
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.23
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.23
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.22
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.22
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.18
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.18
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.16
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.15
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.15
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.15
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.14
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.14
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.13
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.12
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.12
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.12
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.11
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.11
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.11
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.08
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.08
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.08
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.07
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.07
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.06
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.05
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.04
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.04
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.04
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.03
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.02
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.01
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.99
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 98.99
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 98.98
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.98
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 98.97
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 98.96
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 98.96
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.96
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.94
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 98.93
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.92
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 98.92
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.91
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 98.87
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 98.86
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 98.72
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.72
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.69
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.62
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.58
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.42
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 93.08
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 92.53
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 91.92
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 85.37
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.36  E-value=8.1e-14  Score=94.71  Aligned_cols=62  Identities=37%  Similarity=0.509  Sum_probs=42.6

Q ss_pred             CccchhCCccccCCCCCceEEecCCcEEEeeccccccccccCCCCCCCCCCCCCCCChhhhh
Q psy700            1 MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGEGKEEEE   62 (93)
Q Consensus         1 l~~lhs~~iihrdlk~~nill~~~~~~kl~dfgla~~~~~~~~~~~~~~~~~~~~~~p~e~~   62 (93)
                      |.|||+++++||||+|.||+++.++.+||+|||+|+...............++..|++||.-
T Consensus       117 l~yLH~~~ivHrDlKp~NiLl~~~~~~Kl~DFGla~~~~~~~~~~~~~~~~gt~~y~APE~l  178 (276)
T d1uwha_         117 MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVI  178 (276)
T ss_dssp             HHHHHHTTCCCSCCCGGGEEEETTSSEEECCCCCSCC------------CCCCGGGCCHHHH
T ss_pred             HHHHhcCCEeccccCHHHEEEcCCCCEEEccccceeeccccCCcccccccccCcccCCHHHH
Confidence            46999999999999999999999999999999999776544433333444556666666653



>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure