Diaphorina citri psyllid: psy700


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGEGKEEEEEKEEEGEEEDNEKEEKEKKEEEEEEEEEEKN
ccccccccccccccccccEEEEccccEEEccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHc
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYN***************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYLHARGILHKDLKSKNIFIEKNNKVVITDFGLFNFSKLYNSYTSNEKPSSPLGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinase suppressor of Ras 2 Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.confidentQ6VAB6
Kinase suppressor of Ras 2 Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.confidentQ3UVC0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0005078 [MF]MAP-kinase scaffold activityprobableGO:0005488, GO:0005198, GO:0035591, GO:0003674, GO:0032947, GO:0005515, GO:0060090
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0031434 [MF]mitogen-activated protein kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0008595 [BP]anterior/posterior axis specification, embryoprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OMV, chain A
Confidence level:very confident
Coverage over the Query: 1-37,50-62
View the alignment between query and template
View the model in PyMOL