Diaphorina citri psyllid: psy7022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKLKEYRRERRKEKKRKLDDGEEEEEGDQSDLAAIMGFSGFGGGKKK
ccccccccccccccccHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccc
MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLG****VERSSLDQVKKRF*************************************************************IMGFS*FG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKYEQKKKDYDxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLDDGEEEEEGDQSDLAAIMGFSGFGGGKKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger matrin-type protein 2 very confidentQ96NC0
Zinc finger matrin-type protein 2 very confidentQ9CPW7
U4/U6.U5 small nuclear ribonucleoprotein component snu23 confidentQ09776

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F9C, chain B
Confidence level:probable
Coverage over the Query: 5-49
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 54-103
View the alignment between query and template
View the model in PyMOL