Psyllid ID: psy7022
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 124 | ||||||
| 432895643 | 201 | PREDICTED: zinc finger matrin-type prote | 0.975 | 0.601 | 0.715 | 4e-42 | |
| 242006704 | 200 | zinc finger protein matrin type, putativ | 0.975 | 0.605 | 0.747 | 4e-40 | |
| 291235779 | 200 | PREDICTED: zinc finger, matrin type 2-li | 0.959 | 0.595 | 0.760 | 1e-39 | |
| 52346154 | 199 | zinc finger, matrin-type 2 [Xenopus (Sil | 0.975 | 0.608 | 0.723 | 3e-39 | |
| 148231065 | 199 | zinc finger, matrin-type 2 [Xenopus laev | 0.975 | 0.608 | 0.723 | 3e-39 | |
| 391346394 | 211 | PREDICTED: zinc finger matrin-type prote | 0.951 | 0.559 | 0.685 | 1e-38 | |
| 195491704 | 194 | GE20629 [Drosophila yakuba] gi|194179778 | 0.975 | 0.623 | 0.735 | 1e-38 | |
| 91093315 | 199 | PREDICTED: similar to zinc finger matrin | 0.975 | 0.608 | 0.737 | 5e-38 | |
| 194866392 | 194 | GG14201 [Drosophila erecta] gi|190653655 | 0.975 | 0.623 | 0.727 | 1e-37 | |
| 21355873 | 194 | CG11586, isoform A [Drosophila melanogas | 0.975 | 0.623 | 0.727 | 1e-37 |
| >gi|432895643|ref|XP_004076090.1| PREDICTED: zinc finger matrin-type protein 2-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
Score = 174 bits (442), Expect = 4e-42, Method: Compositional matrix adjust.
Identities = 88/123 (71%), Positives = 108/123 (87%), Gaps = 2/123 (1%)
Query: 1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKYEQK 60
M GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRF++N+KK E+K
Sbjct: 79 MGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFEVNRKKMEEK 138
Query: 61 KKDYDIEQRMRELKEEEEKLKEYRRERRKEKKRKLDDGEEEEEGDQSDLAAIMGFSGFGG 120
+K+YD E+RM+EL+EEEEK K YR+E++KE+KR+ + E+ + D ++AA+MGFSGFG
Sbjct: 139 QKEYDFEERMKELREEEEKAKAYRKEKQKERKRRAE--EDLDLEDDDEMAAVMGFSGFGS 196
Query: 121 GKK 123
KK
Sbjct: 197 SKK 199
|
Source: Oryzias latipes Species: Oryzias latipes Genus: Oryzias Family: Adrianichthyidae Order: Beloniformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|242006704|ref|XP_002424187.1| zinc finger protein matrin type, putative [Pediculus humanus corporis] gi|212507528|gb|EEB11449.1| zinc finger protein matrin type, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|291235779|ref|XP_002737824.1| PREDICTED: zinc finger, matrin type 2-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|52346154|ref|NP_001005119.1| zinc finger, matrin-type 2 [Xenopus (Silurana) tropicalis] gi|50370210|gb|AAH77058.1| zinc finger, matrin type 2 [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|148231065|ref|NP_001088651.1| zinc finger, matrin-type 2 [Xenopus laevis] gi|55715630|gb|AAH86293.1| Zmat2-prov protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|391346394|ref|XP_003747459.1| PREDICTED: zinc finger matrin-type protein 2-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|195491704|ref|XP_002093677.1| GE20629 [Drosophila yakuba] gi|194179778|gb|EDW93389.1| GE20629 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|91093315|ref|XP_967938.1| PREDICTED: similar to zinc finger matrin-type protein 2 [Tribolium castaneum] gi|270014187|gb|EFA10635.1| hypothetical protein TcasGA2_TC016272 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194866392|ref|XP_001971872.1| GG14201 [Drosophila erecta] gi|190653655|gb|EDV50898.1| GG14201 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|21355873|ref|NP_647881.1| CG11586, isoform A [Drosophila melanogaster] gi|442630164|ref|NP_001261410.1| CG11586, isoform B [Drosophila melanogaster] gi|195337405|ref|XP_002035319.1| GM13992 [Drosophila sechellia] gi|7292469|gb|AAF47873.1| CG11586, isoform A [Drosophila melanogaster] gi|16769618|gb|AAL29028.1| LD44732p [Drosophila melanogaster] gi|194128412|gb|EDW50455.1| GM13992 [Drosophila sechellia] gi|220944376|gb|ACL84731.1| CG11586-PA [synthetic construct] gi|220954248|gb|ACL89667.1| CG11586-PA [synthetic construct] gi|323301116|gb|ADX35900.1| MIP29039p [Drosophila melanogaster] gi|440215294|gb|AGB94105.1| CG11586, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 124 | ||||||
| ZFIN|ZDB-GENE-030131-3197 | 198 | zmat2 "zinc finger, matrin typ | 0.564 | 0.353 | 0.757 | 4.2e-24 | |
| UNIPROTKB|F1NDH4 | 199 | ZMAT2 "Uncharacterized protein | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| UNIPROTKB|Q5ZIF6 | 199 | ZMAT2 "Uncharacterized protein | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| UNIPROTKB|Q0P584 | 199 | ZMAT2 "Uncharacterized protein | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| UNIPROTKB|E2QZ35 | 199 | ZMAT2 "Uncharacterized protein | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| UNIPROTKB|Q96NC0 | 199 | ZMAT2 "Zinc finger matrin-type | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| UNIPROTKB|I3LF90 | 199 | ZMAT2 "Uncharacterized protein | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| MGI|MGI:1913742 | 199 | Zmat2 "zinc finger, matrin typ | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| RGD|1583592 | 199 | Zmat2 "zinc finger, matrin typ | 0.564 | 0.351 | 0.742 | 8.7e-24 | |
| FB|FBgn0035520 | 194 | CG11586 [Drosophila melanogast | 0.548 | 0.350 | 0.691 | 4.3e-22 |
| ZFIN|ZDB-GENE-030131-3197 zmat2 "zinc finger, matrin type 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
Identities = 53/70 (75%), Positives = 56/70 (80%)
Query: 1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNXXXXXXX 60
M GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRF++N
Sbjct: 76 MGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFEVNKKKLEEK 135
Query: 61 XXXXXIEQRM 70
E+RM
Sbjct: 136 QKEYDFEERM 145
|
|
| UNIPROTKB|F1NDH4 ZMAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIF6 ZMAT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P584 ZMAT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZ35 ZMAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96NC0 ZMAT2 "Zinc finger matrin-type protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LF90 ZMAT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913742 Zmat2 "zinc finger, matrin type 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1583592 Zmat2 "zinc finger, matrin type 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035520 CG11586 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 124 | |||
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 2e-07 | |
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 4e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-04 | |
| pfam12171 | 27 | pfam12171, zf-C2H2_jaz, Zinc-finger double-strande | 5e-04 |
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
Score = 43.8 bits (104), Expect = 2e-07
Identities = 12/30 (40%), Positives = 20/30 (66%)
Query: 3 GYYCNVCDCVVKDSINFLDHINGKKHQRNL 32
G+YC +C+ D I+ H+ GKKH++N+
Sbjct: 3 GFYCKLCNVTFTDEISVEAHLKGKKHKKNV 32
|
Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins. Length = 35 |
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| KOG4727|consensus | 193 | 100.0 | ||
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 99.03 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.87 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.7 | |
| PF08648 | 180 | DUF1777: Protein of unknown function (DUF1777); In | 98.4 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 98.28 | |
| KOG0717|consensus | 508 | 97.87 | ||
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 97.52 | |
| KOG3454|consensus | 165 | 97.22 | ||
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.06 | |
| KOG3408|consensus | 129 | 96.95 | ||
| KOG3263|consensus | 196 | 96.71 | ||
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 96.69 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.55 | |
| KOG2837|consensus | 309 | 96.5 | ||
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.36 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.27 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 95.88 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 95.78 | |
| PF03194 | 254 | LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa | 95.6 | |
| KOG2384|consensus | 223 | 95.51 | ||
| PLN02748 | 468 | tRNA dimethylallyltransferase | 95.42 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 95.26 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 95.07 | |
| KOG3032|consensus | 264 | 94.67 | ||
| KOG2785|consensus | 390 | 94.41 | ||
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 93.97 | |
| KOG0150|consensus | 336 | 93.82 | ||
| PHA00616 | 44 | hypothetical protein | 91.9 | |
| KOG0227|consensus | 222 | 90.5 | ||
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 90.23 | |
| KOG0796|consensus | 319 | 90.03 | ||
| KOG2785|consensus | 390 | 89.99 | ||
| COG5136 | 188 | U1 snRNP-specific protein C [RNA processing and mo | 89.7 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 88.63 | |
| PF11931 | 196 | DUF3449: Domain of unknown function (DUF3449); Int | 88.5 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 88.16 | |
| PTZ00448 | 373 | hypothetical protein; Provisional | 86.73 | |
| smart00734 | 26 | ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 | 85.54 | |
| PF06658 | 142 | DUF1168: Protein of unknown function (DUF1168); In | 83.53 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 82.78 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 82.74 | |
| PF04959 | 214 | ARS2: Arsenite-resistance protein 2; InterPro: IPR | 82.7 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 81.13 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 80.42 |
| >KOG4727|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-45 Score=284.87 Aligned_cols=121 Identities=69% Similarity=1.122 Sum_probs=111.0
Q ss_pred CCCccccccCceecchhhHhhhhccHHHHHHhccccccccccHHHHHHHHHHHHHHHHhhhhcccHHHHHHHHHHHHHHH
Q psy7022 1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKL 80 (124)
Q Consensus 1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~ver~tle~V~~rl~~lk~k~~~~~~~~~~~eRl~~~~eeEek~ 80 (124)
++||||.||||+|+||++|||||||+.|++|+||||+|+|+||+||+.||+.++.+.+.....+++++||.+.+++|++.
T Consensus 73 ~~GyyCdVCdcvvKDSinflDHiNgKkHqrnlgmsm~verst~~qv~erf~~~k~k~~~~~ke~~vE~r~~e~qeee~rl 152 (193)
T KOG4727|consen 73 KGGYYCDVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKERFEQNKKKMEEKQKEYDVEERLRETQEEEERL 152 (193)
T ss_pred cCceeeeecceeehhhHHHHHHhccHHHHHHHhhhhcchhhhHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence 48999999999999999999999999999999999999999999999999999998888889999999999999999999
Q ss_pred HHHHHHHHHHHHhhhccCCccccCChHHHHHHhCCCCCCCCCC
Q psy7022 81 KEYRRERRKEKKRKLDDGEEEEEGDQSDLAAIMGFSGFGGGKK 123 (124)
Q Consensus 81 re~rr~kkkekk~~~~~~~~~~~~~~~emaamMGF~gFGssKK 123 (124)
+..+++|++++|+...+..+.+ ..|||+|||||||||+|||
T Consensus 153 kd~~kEK~ke~K~~t~~di~~e--s~~~~~amMGFSgF~tsKk 193 (193)
T KOG4727|consen 153 KDTRKEKKKEKKRATKEDIDFE--SKDEMAAMMGFSGFGTSKK 193 (193)
T ss_pred HHHHHHHHHHHhhccccccccc--ccHHHHHHhCccccccCCC
Confidence 9999999988887765432222 2489999999999999997
|
|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF08648 DUF1777: Protein of unknown function (DUF1777); InterPro: IPR013957 This entry shows eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3454|consensus | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3408|consensus | Back alignment and domain information |
|---|
| >KOG3263|consensus | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >KOG2837|consensus | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >KOG3032|consensus | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0150|consensus | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >KOG0227|consensus | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >KOG0796|consensus | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >COG5136 U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11931 DUF3449: Domain of unknown function (DUF3449); InterPro: IPR024598 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PTZ00448 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger | Back alignment and domain information |
|---|
| >PF06658 DUF1168: Protein of unknown function (DUF1168); InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 124 | |||
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-04 |
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Score = 37.1 bits (85), Expect = 5e-04
Identities = 8/52 (15%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
Query: 54 KKKYEQKKKDYDIEQRMRELKEEEEKLKE--YRRERRKEKKRKLDDGEEEEE 103
+++ ++ D + +E +E+ +K E +R+ + +K K+++ ++
Sbjct: 93 EQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKA 144
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 98.65 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 98.09 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 97.94 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 97.51 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 96.12 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.07 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 95.99 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 95.98 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 95.95 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.83 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 95.81 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 95.76 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.75 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 95.71 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 95.68 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.61 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 94.6 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 95.57 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 95.55 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.51 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.51 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.47 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 95.39 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 95.35 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.32 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.32 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.27 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.26 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.26 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.25 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.21 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 95.16 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.16 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 95.11 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 95.0 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.93 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.93 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.92 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 94.91 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 94.86 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.85 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 94.85 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.83 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.82 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.82 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 94.79 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 94.78 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 94.76 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.75 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.75 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 94.74 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 94.68 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.66 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.65 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.65 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.64 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.64 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.63 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 94.62 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 94.62 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.6 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.6 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.6 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.6 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.59 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.55 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.55 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.54 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 94.54 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.53 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.49 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.48 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.48 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.47 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 94.47 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.46 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.46 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 94.46 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.46 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.44 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.44 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.43 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.42 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.42 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.42 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.41 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.4 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 94.39 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.39 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.37 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 94.36 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.36 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.36 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.34 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.34 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.34 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.32 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.32 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.32 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.31 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.28 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.28 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.28 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.27 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.26 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.26 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.26 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 94.25 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.24 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.24 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.24 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.24 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.18 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.17 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 94.16 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.15 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 94.15 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.15 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.13 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.13 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 94.13 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.12 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 94.11 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 94.1 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.1 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 94.09 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.08 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.07 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.01 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.0 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 93.99 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.91 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.88 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.88 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.83 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.82 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.79 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 93.78 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 93.78 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.74 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 93.74 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 93.68 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 93.67 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 93.66 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 93.4 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 93.37 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 93.34 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 93.34 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 93.1 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 93.1 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 93.08 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 93.05 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 93.04 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 93.02 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 93.01 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 92.96 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 92.93 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 92.91 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 92.88 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.86 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 92.83 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 92.71 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 92.64 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 92.62 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 92.59 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 92.57 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 92.28 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 92.2 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 92.16 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 92.09 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 92.08 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 91.91 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 91.82 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 91.73 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 91.68 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 91.68 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 91.55 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 91.5 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 91.47 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 91.41 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 91.35 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 91.28 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 90.91 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 90.87 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 90.86 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 90.4 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 90.35 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 90.16 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 90.07 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 89.96 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 89.78 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 89.54 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 89.27 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 89.21 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 89.14 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 89.14 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 88.96 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 88.74 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 88.72 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 88.4 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 88.25 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 88.15 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 88.03 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 87.77 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 87.66 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 87.47 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 87.18 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 86.95 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 86.91 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 86.84 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 86.34 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 86.25 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 85.8 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 85.6 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 85.35 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 85.3 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 85.27 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 85.04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 85.0 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 83.8 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 83.21 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 82.78 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 82.32 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 82.16 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 81.42 |
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
Probab=98.65 E-value=9.9e-09 Score=69.52 Aligned_cols=32 Identities=38% Similarity=0.782 Sum_probs=28.6
Q ss_pred CCCccccccCcee-cchhh-HhhhhccHHHHHHh
Q psy7022 1 MLGYYCNVCDCVV-KDSIN-FLDHINGKKHQRNL 32 (124)
Q Consensus 1 ~~gfyC~vCd~~f-kDs~~-~ldHlngk~H~~~~ 32 (124)
+++|||++||++| .||.+ +..|++|.+|+.|+
T Consensus 1 mPkYyCdYCd~~lt~Ds~s~Rk~H~~G~kH~~nv 34 (77)
T 3cw1_L 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENV 34 (77)
T ss_pred CCCcccccCCceecCCCHHHHHHHHccHHHHHHH
Confidence 5799999999999 78776 99999999999854
|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 98.73 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 98.14 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.66 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.05 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 95.77 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 95.69 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.66 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 95.66 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 95.5 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 95.36 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.24 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.02 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 95.01 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 94.93 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 94.91 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 94.88 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 94.7 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 94.37 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.81 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 93.53 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 93.24 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 92.98 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 92.49 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 92.36 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 91.79 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 91.37 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 90.59 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 90.31 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 89.06 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 88.97 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 88.94 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 88.4 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 88.21 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 87.65 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 86.89 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 86.68 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 86.4 | |
| d2ghfa2 | 36 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 86.04 | |
| d1ubdc1 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 83.63 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.6 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 80.95 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 80.49 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 80.11 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73 E-value=1.7e-09 Score=69.99 Aligned_cols=30 Identities=27% Similarity=0.374 Sum_probs=28.0
Q ss_pred CCccccccCceecchhhHhhhhccHHHHHH
Q psy7022 2 LGYYCNVCDCVVKDSINFLDHINGKKHQRN 31 (124)
Q Consensus 2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~~ 31 (124)
+-|||.+|+++|.+..+|.+|++|++|.++
T Consensus 14 gqfYCv~C~K~F~se~~l~~H~ksKkHKrr 43 (67)
T d1zr9a1 14 GLHRCLACARYFIDSTNLKTHFRSKDHKKR 43 (67)
T ss_dssp GCSEETTTTEECSSHHHHHHHTTCHHHHHH
T ss_pred CEEecccccCccCCHHHHHHHHcccHHHHH
Confidence 569999999999999999999999999873
|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|