Diaphorina citri psyllid: psy7025


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSDSNEEDNNPALEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ
cccccccccHHHHHcccEEEEcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccc
**GKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHS*****************************************************************************************
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSDSNEEDNNPALEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P4O, chain A
Confidence level:very confident
Coverage over the Query: 2-117
View the alignment between query and template
View the model in PyMOL
Template: 2EHB, chain D
Confidence level:probable
Coverage over the Query: 148-191
View the alignment between query and template
View the model in PyMOL