Psyllid ID: psy7025


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSDSNEEDNNPALEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ
cccccccccHHHHHcccEEEEcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccc
ccccccEEEHHHHcccccEEHHHccHEEccccccccHHHHHHHHHHHHHHHcccccccHHccccccccccccHHHHHHHHHHccccHHHcccHHHHHHHHHHHccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccc
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILqstgasmvgggilvrpdncpdrLFNLMRRcwqfkpqarpTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAetrtssttldeqiplrsaediedfslssdsneednnpaleeddrgvMKYRNNAVDTYVSCFVLDvsglnssrlsq
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKaetrtssttldeqiplrsaEDIEDfslssdsneednnpaleeddrgvMKYRNNAVDTYVSCFVLdvsglnssrlsq
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIedfslssdsneednnPALEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ
***KHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRL**************************************************MKYRNNAVDTYVSCFVLDVS*********
**GKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYY*******************************************************************************************
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAK***********EQIPLRSAEDIEDF**************LEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ
**GKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHS*****************************************************************************************
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKHWLLGLLRYVLGKILCIATGASMVATGASMVGKHWLLGLLRYVLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSDSNEEDNNPALEEDDRGVMKYRNNAVDTYVSCFVLDVSGLNSSRLSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query205 2.2.26 [Sep-21-2011]
Q931051393 Insulin-like receptor OS= N/A N/A 0.419 0.061 0.445 1e-16
Q05688640 Insulin-like growth facto yes N/A 0.268 0.085 0.545 4e-15
P080691367 Insulin-like growth facto yes N/A 0.287 0.043 0.516 6e-15
O737981358 Insulin-like growth facto N/A N/A 0.409 0.061 0.423 1e-14
Q607511373 Insulin-like growth facto yes N/A 0.268 0.040 0.527 2e-14
P240621370 Insulin-like growth facto yes N/A 0.268 0.040 0.527 2e-14
P062131382 Insulin receptor OS=Homo no N/A 0.302 0.044 0.523 3e-14
P151271383 Insulin receptor OS=Rattu no N/A 0.302 0.044 0.523 2e-13
P152081372 Insulin receptor OS=Mus m no N/A 0.302 0.045 0.523 2e-13
P09208 2144 Insulin-like receptor OS= yes N/A 0.570 0.054 0.322 8e-13
>sp|Q93105|INSR_AEDAE Insulin-like receptor OS=Aedes aegypti GN=InR PE=2 SV=2 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 60/92 (65%), Gaps = 6/92 (6%)

Query: 59   MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAA 118
            ++ GG++ RP+NCPD L+NLMRRCWQ +P ARPTFMEI+++L  D +  F+ V++Y+S  
Sbjct: 1253 VIDGGVMERPENCPDNLYNLMRRCWQHRPTARPTFMEIISELLPDASPHFQDVAFYNSQD 1312

Query: 119  CAENKLRLAAKAETRTSSTTLDEQIPLRSAED 150
             A + LR   +      +TT     PLR  +D
Sbjct: 1313 -ALDMLRGQHQTVIIDEATT-----PLRPGDD 1338




This receptor probably binds an insulin related protein and has a tyrosine-protein kinase activity.
Aedes aegypti (taxid: 7159)
EC: 2EC: .EC: 7EC: .EC: 1EC: 0EC: .EC: 1
>sp|Q05688|IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus GN=IGF1R PE=2 SV=1 Back     alignment and function description
>sp|P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens GN=IGF1R PE=1 SV=1 Back     alignment and function description
>sp|O73798|IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis GN=igf1r PE=1 SV=1 Back     alignment and function description
>sp|Q60751|IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus GN=Igf1r PE=1 SV=3 Back     alignment and function description
>sp|P24062|IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus GN=Igf1r PE=2 SV=2 Back     alignment and function description
>sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 Back     alignment and function description
>sp|P15127|INSR_RAT Insulin receptor OS=Rattus norvegicus GN=Insr PE=1 SV=1 Back     alignment and function description
>sp|P15208|INSR_MOUSE Insulin receptor OS=Mus musculus GN=Insr PE=1 SV=2 Back     alignment and function description
>sp|P09208|INSR_DROME Insulin-like receptor OS=Drosophila melanogaster GN=InR PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
189233909 1450 PREDICTED: similar to insulin receptor, 0.575 0.081 0.406 4e-18
270015135 1363 insulin-like receptor [Tribolium castane 0.575 0.086 0.406 5e-18
205371763 1393 RecName: Full=Insulin-like receptor; Sho 0.419 0.061 0.445 5e-15
157127985 1371 insulin receptor [Aedes aegypti] gi|1088 0.419 0.062 0.445 5e-15
1620750 1390 insulin receptor [Aedes aegypti] 0.419 0.061 0.445 5e-15
156402674301 predicted protein [Nematostella vectensi 0.331 0.225 0.5 5e-15
399108294 350 insulin receptor, partial [Trypoxylus di 0.619 0.362 0.378 6e-15
30750130 322 Chain A, Structure Of Apo Unactivated Ig 0.292 0.186 0.523 4e-14
28373614 322 Chain A, Crystal Structure Of Unactivate 0.292 0.186 0.523 4e-14
181330584 1348 insulin receptor b precursor [Danio reri 0.492 0.074 0.378 5e-14
>gi|189233909|ref|XP_972770.2| PREDICTED: similar to insulin receptor, partial [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 77/128 (60%), Gaps = 10/128 (7%)

Query: 59   MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAA 118
            ++ GG++ RP+NCPD+L+ LMR CWQ KP ARP+F+++ + L  D + SF QVS+YHSAA
Sbjct: 1307 VIDGGVMERPENCPDKLYTLMRYCWQHKPSARPSFLKLCSLLLEDASTSFAQVSFYHSAA 1366

Query: 119  CAENKLRLAAKAETRTSSTTLDEQIPLRSAEDIE-DFSLSSDSNEEDNNPALEEDDRGVM 177
              E     A  +    S +  D   PLR A D + +FSL+SD    D+N   E D    +
Sbjct: 1367 GIE-----ARSSRPTPSPSQDDPSTPLRIAGDHDVNFSLNSD----DSNDEFETDAETHI 1417

Query: 178  KYRNNAVD 185
            ++ +  V+
Sbjct: 1418 RFPSIPVE 1425




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270015135|gb|EFA11583.1| insulin-like receptor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|205371763|sp|Q93105.2|INSR_AEDAE RecName: Full=Insulin-like receptor; Short=MIR; Contains: RecName: Full=Insulin-like receptor alpha chain; Contains: RecName: Full=Insulin-like receptor beta chain; Flags: Precursor Back     alignment and taxonomy information
>gi|157127985|ref|XP_001661260.1| insulin receptor [Aedes aegypti] gi|108882320|gb|EAT46545.1| AAEL002317-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|1620750|gb|AAB17094.1| insulin receptor [Aedes aegypti] Back     alignment and taxonomy information
>gi|156402674|ref|XP_001639715.1| predicted protein [Nematostella vectensis] gi|156226845|gb|EDO47652.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|399108294|gb|AFP20576.1| insulin receptor, partial [Trypoxylus dichotomus] Back     alignment and taxonomy information
>gi|30750130|pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. gi|30750131|pdb|1P4O|B Chain B, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution Back     alignment and taxonomy information
>gi|28373614|pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain gi|28373615|pdb|1M7N|B Chain B, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Back     alignment and taxonomy information
>gi|181330584|ref|NP_001116701.1| insulin receptor b precursor [Danio rerio] gi|185178068|gb|ACC77575.1| insulin receptor b [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
UNIPROTKB|Q931051393 InR "Insulin-like receptor" [A 0.414 0.061 0.430 9.7e-15
UNIPROTKB|O737981358 igf1r "Insulin-like growth fac 0.409 0.061 0.423 1.1e-14
UNIPROTKB|F1NG98217 IGF1R "Uncharacterized protein 0.380 0.359 0.416 1.1e-14
UNIPROTKB|F1P4Y7221 IGF1R "Uncharacterized protein 0.380 0.352 0.416 1.1e-14
UNIPROTKB|F1CK171367 IGF1R "Tyrosine-protein kinase 0.287 0.043 0.516 2.2e-14
UNIPROTKB|Q05688640 IGF1R "Insulin-like growth fac 0.287 0.092 0.532 3e-14
UNIPROTKB|C9J5X11366 IGF1R "Insulin-like growth fac 0.292 0.043 0.523 5.3e-14
UNIPROTKB|P080691367 IGF1R "Insulin-like growth fac 0.292 0.043 0.523 5.3e-14
UNIPROTKB|G1K2181154 IGF1R "Tyrosine-protein kinase 0.287 0.051 0.532 7e-14
ZFIN|ZDB-GENE-020503-21380 igf1rb "insulin-like growth fa 0.414 0.061 0.388 8.7e-14
UNIPROTKB|Q93105 InR "Insulin-like receptor" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 9.7e-15, P = 9.7e-15
 Identities = 40/93 (43%), Positives = 60/93 (64%)

Query:    59 MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAA 118
             ++ GG++ RP+NCPD L+NLMRRCWQ +P ARPTFMEI+++L  D +  F+ V++Y+S  
Sbjct:  1253 VIDGGVMERPENCPDNLYNLMRRCWQHRPTARPTFMEIISELLPDASPHFQDVAFYNSQD 1312

Query:   119 CAENKLRLAAKAETRTSSTTLDEQI-PLRSAED 150
               +    L  + +T      +DE   PLR  +D
Sbjct:  1313 ALD---MLRGQHQT----VIIDEATTPLRPGDD 1338




GO:0005009 "insulin-activated receptor activity" evidence=ISS
GO:0008286 "insulin receptor signaling pathway" evidence=ISS
GO:0042169 "SH2 domain binding" evidence=ISS
GO:0043548 "phosphatidylinositol 3-kinase binding" evidence=ISS
GO:0043559 "insulin binding" evidence=ISS
GO:0043560 "insulin receptor substrate binding" evidence=ISS
GO:0046777 "protein autophosphorylation" evidence=ISS
GO:0051290 "protein heterotetramerization" evidence=ISS
GO:0051425 "PTB domain binding" evidence=ISS
UNIPROTKB|O73798 igf1r "Insulin-like growth factor 1 receptor" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG98 IGF1R "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4Y7 IGF1R "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1CK17 IGF1R "Tyrosine-protein kinase receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q05688 IGF1R "Insulin-like growth factor 1 receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J5X1 IGF1R "Insulin-like growth factor 1 receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P08069 IGF1R "Insulin-like growth factor 1 receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G1K218 IGF1R "Tyrosine-protein kinase receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020503-2 igf1rb "insulin-like growth factor 1b receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 2e-16
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 6e-14
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 4e-13
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-12
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 5e-11
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-10
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 3e-10
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 7e-10
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-09
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-09
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 4e-09
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 5e-09
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 5e-09
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 8e-09
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 1e-08
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 2e-08
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 3e-08
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-08
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-07
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 1e-07
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 1e-07
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-07
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-07
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-07
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 3e-07
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-07
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 5e-07
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 8e-07
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-06
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-06
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-06
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-06
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 2e-06
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-06
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-06
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 5e-06
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 6e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 7e-06
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 8e-06
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-05
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-05
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 1e-05
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 1e-05
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 3e-05
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-05
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 3e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 5e-05
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 8e-05
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 9e-05
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-04
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 2e-04
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-04
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 2e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 5e-04
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 5e-04
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 7e-04
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 7e-04
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 0.001
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 0.001
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.001
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.002
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.002
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 0.002
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.002
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 0.002
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.003
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 0.003
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 0.003
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 0.004
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.004
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 0.004
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
 Score = 75.0 bits (184), Expect = 2e-16
 Identities = 29/52 (55%), Positives = 40/52 (76%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSY 113
           GG L +PDNCP+R+ +LMR CWQF P+ RPTF+EI+  L+ D+  SF +VS+
Sbjct: 237 GGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSF 288


Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein metabolism, ion and amino acid transport, cell cycle and proliferation, cell differentiation, gene transcription, and nitric oxide synthesis. Insulin resistance, caused by abnormalities in InsR signaling, has been described in diabetes, hypertension, cardiovascular disease, metabolic syndrome, heart failure, and female infertility. Length = 288

>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 205
KOG0197|consensus468 99.95
KOG1026|consensus774 99.92
KOG4278|consensus 1157 99.91
KOG1095|consensus1025 99.91
KOG4257|consensus 974 99.9
KOG0196|consensus996 99.89
KOG0192|consensus362 99.88
KOG0200|consensus609 99.88
KOG0199|consensus 1039 99.84
KOG1024|consensus563 99.81
KOG4721|consensus 904 99.81
PHA02988283 hypothetical protein; Provisional 99.8
KOG0581|consensus364 99.77
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.77
KOG0194|consensus474 99.76
KOG0591|consensus375 99.76
KOG1025|consensus 1177 99.76
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.75
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.74
KOG0575|consensus 592 99.74
KOG1094|consensus807 99.73
KOG0193|consensus678 99.73
KOG0596|consensus677 99.72
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.72
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.71
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.71
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.71
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.71
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.7
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.7
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.7
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.7
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.7
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.7
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.69
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.69
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.69
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.69
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.69
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.69
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.69
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.69
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.69
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.69
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.68
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.68
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.68
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.68
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.68
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.68
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.67
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.67
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.67
KOG0578|consensus550 99.67
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.67
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.67
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.66
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.66
KOG0198|consensus313 99.66
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.66
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.66
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.66
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.66
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.66
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.66
KOG0201|consensus467 99.66
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.66
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.65
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.65
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.65
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.65
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.65
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.65
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.65
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.65
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.65
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.65
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.64
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.64
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.64
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.64
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.64
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.64
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.64
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.64
PTZ00283496 serine/threonine protein kinase; Provisional 99.64
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.63
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.63
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.63
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.63
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.62
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.62
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.62
KOG0661|consensus 538 99.62
KOG1187|consensus361 99.61
PTZ00267478 NIMA-related protein kinase; Provisional 99.61
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.61
KOG0588|consensus 786 99.61
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.61
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.61
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.61
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.61
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.61
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.6
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.6
KOG0583|consensus370 99.6
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.59
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.59
PHA02882294 putative serine/threonine kinase; Provisional 99.59
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.59
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.59
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.59
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.59
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.59
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.59
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.59
KOG0615|consensus475 99.59
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.59
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.59
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.59
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.58
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.58
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.58
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.58
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.57
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.57
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.57
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.57
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.57
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.57
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.56
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.56
KOG0983|consensus391 99.56
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.56
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.56
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.56
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.56
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.55
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.55
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.55
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.55
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.55
KOG0589|consensus426 99.55
PTZ00036440 glycogen synthase kinase; Provisional 99.55
KOG0598|consensus357 99.55
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.54
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.54
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.53
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.53
KOG0597|consensus 808 99.53
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.53
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.53
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.53
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.53
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.53
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.53
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.53
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.52
KOG4279|consensus 1226 99.52
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.52
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.52
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.52
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.52
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.52
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.52
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.52
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.52
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.52
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.51
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.51
KOG0592|consensus 604 99.51
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.51
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.51
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.51
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.51
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.51
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.51
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.51
PTZ00284467 protein kinase; Provisional 99.51
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.51
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.51
KOG0616|consensus355 99.5
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.5
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.5
KOG4645|consensus1509 99.5
KOG2345|consensus302 99.5
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.5
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.5
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.5
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.5
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.49
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.49
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.49
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.49
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.49
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.49
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.49
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.49
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.49
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.49
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.49
KOG0694|consensus694 99.48
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.48
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.48
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.48
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.48
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.48
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.48
KOG0595|consensus429 99.48
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.48
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.48
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.48
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.48
KOG0593|consensus396 99.47
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.47
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.47
KOG0603|consensus612 99.47
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.47
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.47
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.47
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.47
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.46
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.46
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.46
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.46
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.46
KOG0577|consensus 948 99.46
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.46
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.46
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.46
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.46
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.45
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.45
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.45
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.45
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.45
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.45
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.45
KOG0033|consensus355 99.45
KOG0582|consensus 516 99.45
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.45
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.45
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.45
KOG4717|consensus 864 99.44
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.44
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.44
KOG0584|consensus 632 99.44
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.44
PHA03207392 serine/threonine kinase US3; Provisional 99.44
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.44
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.44
KOG0660|consensus359 99.43
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.43
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.43
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.43
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.43
KOG0599|consensus411 99.43
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.43
KOG1006|consensus361 99.43
PHA03209357 serine/threonine kinase US3; Provisional 99.42
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.42
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.42
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.42
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.42
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.42
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.42
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.42
KOG0579|consensus 1187 99.42
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.42
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.42
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.41
KOG1989|consensus 738 99.41
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.41
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.41
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.41
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.41
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.41
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.41
PHA03212391 serine/threonine kinase US3; Provisional 99.41
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.41
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.4
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.4
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.4
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.4
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.4
KOG0574|consensus 502 99.4
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.4
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.4
PHA03211461 serine/threonine kinase US3; Provisional 99.4
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.4
PLN00181 793 protein SPA1-RELATED; Provisional 99.4
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.4
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.39
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.39
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.38
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.38
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.38
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.38
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.38
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.38
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.38
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.38
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.38
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.37
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.37
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.37
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.37
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.37
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.37
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.37
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.36
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.36
PHA03210501 serine/threonine kinase US3; Provisional 99.36
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.36
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.36
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.36
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.35
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.35
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.35
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.35
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.34
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.34
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.34
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.34
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.34
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.34
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.33
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.33
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.33
KOG0604|consensus400 99.32
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.32
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.32
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.32
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.31
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.31
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.31
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.3
PLN00009294 cyclin-dependent kinase A; Provisional 99.3
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.3
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.3
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.3
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.3
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.3
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.29
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.29
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.29
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.29
KOG0032|consensus382 99.28
KOG0585|consensus576 99.28
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.27
KOG3653|consensus534 99.27
KOG0580|consensus281 99.27
KOG0671|consensus415 99.27
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.26
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.25
KOG0659|consensus318 99.25
KOG2052|consensus513 99.25
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.24
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.23
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.23
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.22
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.22
KOG0658|consensus364 99.22
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.21
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.21
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.2
KOG1151|consensus775 99.19
KOG0611|consensus 668 99.19
KOG0614|consensus732 99.19
KOG1035|consensus 1351 99.18
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.17
KOG0690|consensus516 99.16
KOG0696|consensus683 99.16
KOG0600|consensus560 99.15
KOG0587|consensus 953 99.15
KOG0667|consensus586 99.15
KOG0586|consensus 596 99.11
KOG0984|consensus282 99.11
KOG0986|consensus591 99.09
KOG1023|consensus 484 99.08
KOG1027|consensus903 99.07
KOG0663|consensus419 99.01
KOG0594|consensus323 99.0
KOG0195|consensus448 98.97
KOG0612|consensus 1317 98.92
KOG0605|consensus550 98.91
KOG0607|consensus463 98.9
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 98.86
KOG4250|consensus 732 98.83
KOG1290|consensus590 98.82
KOG4236|consensus888 98.8
PLN03224507 probable serine/threonine protein kinase; Provisio 98.77
KOG0610|consensus459 98.77
KOG0695|consensus593 98.72
KOG1345|consensus378 98.69
KOG0670|consensus752 98.66
KOG0664|consensus449 98.65
KOG1033|consensus516 98.63
KOG0666|consensus438 98.61
KOG0576|consensus 829 98.61
KOG0669|consensus376 98.6
KOG0665|consensus369 98.52
KOG0608|consensus1034 98.34
KOG0603|consensus 612 98.32
KOG4158|consensus598 98.29
KOG0590|consensus601 98.23
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.21
KOG0662|consensus292 98.11
KOG0606|consensus 1205 97.9
KOG0668|consensus338 97.89
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 97.8
COG0515384 SPS1 Serine/threonine protein kinase [General func 97.55
KOG1240|consensus 1431 96.74
KOG1167|consensus418 96.57
KOG1164|consensus322 96.45
KOG0590|consensus 601 95.78
PF0382263 NAF: NAF domain; InterPro: IPR004041 The NAF domai 95.77
KOG2137|consensus 700 94.51
KOG0601|consensus524 94.21
KOG1266|consensus458 93.82
KOG1093|consensus 725 92.62
KOG1165|consensus449 90.48
COG4248 637 Uncharacterized protein with protein kinase and he 88.48
KOG1163|consensus341 86.5
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 85.23
KOG0606|consensus1205 84.74
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 83.02
KOG1152|consensus772 80.28
KOG1166|consensus974 80.01
>KOG0197|consensus Back     alignment and domain information
Probab=99.95  E-value=3.9e-28  Score=206.37  Aligned_cols=105  Identities=30%  Similarity=0.524  Sum_probs=94.1

Q ss_pred             CeEEEeccccceEecCCeeEeecCCc----ccCCCC------CCccchHHHHHHHHHH---hhccH------HHHHHHhc
Q psy7025           1 MVGKHWLLGLLRYVLGKILCIATGAS----MVATGA------SMVGKHWLLGLLRYVL---GKILQ------STGASMVG   61 (205)
Q Consensus         1 ~~aKl~DFGlar~~~~~~~~~~~~~~----~~aPE~------~~ksDvwS~Gvvl~El---g~~p~------~~~~~i~~   61 (205)
                      .++||+||||||.+.++.|+...+.+    |.|||.      +.|||||||||+||||   |+.|+      ++.+.+.+
T Consensus       340 ~~vKIsDFGLAr~~~d~~Y~~~~~~kfPIkWtAPEa~~~~~FS~kSDVWSFGVlL~E~fT~G~~py~~msn~ev~~~le~  419 (468)
T KOG0197|consen  340 LVVKISDFGLARLIGDDEYTASEGGKFPIKWTAPEALNYGKFSSKSDVWSFGVLLWELFTYGRVPYPGMSNEEVLELLER  419 (468)
T ss_pred             ceEEEcccccccccCCCceeecCCCCCCceecCHHHHhhCCcccccceeehhhhHHHHhccCCCCCCCCCHHHHHHHHhc
Confidence            47999999999988888898887764    479998      7899999999999999   88874      67888999


Q ss_pred             CCCCCCCCCCcHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHH
Q psy7025          62 GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIA  105 (205)
Q Consensus        62 ~~~~~~p~~~~~~l~~li~~C~~~~p~~Rps~~ei~~~l~~~~~  105 (205)
                      |+|+++|..||+++++||..||+.+|++||||..+...+.++..
T Consensus       420 GyRlp~P~~CP~~vY~lM~~CW~~~P~~RPtF~~L~~~l~~~~~  463 (468)
T KOG0197|consen  420 GYRLPRPEGCPDEVYELMKSCWHEDPEDRPTFETLREVLEDFFT  463 (468)
T ss_pred             cCcCCCCCCCCHHHHHHHHHHhhCCcccCCCHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999988887776654



>KOG1026|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PF03822 NAF: NAF domain; InterPro: IPR004041 The NAF domain is a 24 amino acid domain that is found in a plant-specific subgroup of serine-threonine protein kinases (CIPKs), that interact with calcineurin B-like calcium sensor proteins (CBLs) Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 6e-17
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 6e-17
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 8e-17
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 1e-16
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 2e-16
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 2e-16
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 2e-16
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 2e-16
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 2e-16
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 2e-16
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 9e-16
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 1e-15
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-15
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 1e-15
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-15
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-15
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 1e-15
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 2e-15
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 2e-15
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 2e-15
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 1e-07
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-07
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-07
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-07
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-07
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-07
2pl0_A289 Lck Bound To Imatinib Length = 289 1e-07
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 1e-07
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-07
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-07
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 1e-07
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-07
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 1e-07
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-07
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 2e-07
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 2e-07
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 2e-07
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 5e-07
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 5e-07
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 6e-07
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 7e-07
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 7e-07
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 7e-07
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 8e-07
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 8e-07
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 8e-07
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-07
1fvr_A327 Tie2 Kinase Domain Length = 327 8e-07
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-07
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-07
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 8e-07
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-07
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 8e-07
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 8e-07
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 8e-07
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 8e-07
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-07
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 9e-07
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 9e-07
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 9e-07
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 9e-07
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 9e-07
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 9e-07
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-06
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 2e-06
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-06
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-06
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-06
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 2e-06
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-06
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 2e-06
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-06
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 2e-06
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-06
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-06
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 3e-06
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 3e-06
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 4e-06
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 4e-06
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 4e-06
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 5e-06
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 5e-06
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 6e-06
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 7e-06
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-05
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-05
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3b2t_A311 Structure Of Phosphotransferase Length = 311 1e-05
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-05
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 1e-05
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 2e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 2e-05
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-05
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 2e-05
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 2e-05
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 2e-05
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 2e-05
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-05
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 2e-05
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 2e-05
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 2e-05
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 2e-05
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 2e-05
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 2e-05
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-05
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-05
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 2e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-05
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 2e-05
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 2e-05
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 2e-05
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 2e-05
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 2e-05
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 2e-05
3a4o_X286 Lyn Kinase Domain Length = 286 2e-05
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 3e-05
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 3e-05
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 3e-05
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 3e-05
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 3e-05
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 3e-05
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 3e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 3e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 3e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 3e-05
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-05
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 4e-05
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 4e-05
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 4e-05
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-05
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-05
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 4e-05
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 5e-05
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 5e-05
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 5e-05
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 5e-05
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 5e-05
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 5e-05
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 5e-05
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 5e-05
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 5e-05
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-05
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 5e-05
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 5e-05
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 8e-05
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 9e-05
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 1e-04
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-04
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-04
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-04
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-04
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-04
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-04
2g15_A318 Structural Characterization Of Autoinhibited C-Met 1e-04
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
3lxn_A318 Structural And Thermodynamic Characterization Of Th 1e-04
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 2e-04
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 2e-04
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-04
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-04
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 3e-04
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 3e-04
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 3e-04
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 3e-04
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-04
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 4e-04
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 4e-04
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 5e-04
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 5e-04
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-04
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 5e-04
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 6e-04
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 7e-04
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 7e-04
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 7e-04
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 8e-04
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 9e-04
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure

Iteration: 1

Score = 84.0 bits (206), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 3/63 (4%) Query: 62 GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAE 121 GG+L +PDNCPD LF LMR CWQ+ P+ RP+F+EI++ ++ ++ FR+VS+Y+S E Sbjct: 256 GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYS---EE 312 Query: 122 NKL 124 NKL Sbjct: 313 NKL 315
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query205
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 2e-21
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 4e-18
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 1e-16
2xir_A316 Vascular endothelial growth factor receptor 2; ang 2e-16
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-16
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 2e-16
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 7e-16
3pls_A298 Macrophage-stimulating protein receptor; protein k 9e-16
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-15
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 1e-15
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 1e-15
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-15
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-15
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-15
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-15
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-15
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-15
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 5e-15
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 6e-15
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 7e-15
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 7e-15
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 8e-15
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-14
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-14
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-14
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-13
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-13
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-13
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-13
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-13
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-13
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-13
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 5e-13
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 6e-13
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 7e-13
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 7e-13
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 7e-13
3poz_A327 Epidermal growth factor receptor; kinase domain, a 7e-13
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 8e-13
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 9e-13
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 9e-13
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-13
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-12
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-12
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 1e-12
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-12
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-12
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-12
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 4e-12
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 5e-12
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-11
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-11
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 8e-11
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-10
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-10
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-10
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-10
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-10
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-10
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-10
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-09
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 6e-07
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-06
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 3e-06
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 5e-05
3soc_A322 Activin receptor type-2A; structural genomics cons 7e-05
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 2e-21
 Identities = 29/55 (52%), Positives = 44/55 (80%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHS 116
           GG+L +PDNCPD LF LMR CWQ+ P+ RP+F+EI++ ++ ++   FR+VS+Y+S
Sbjct: 256 GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYS 310


>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.92
4aoj_A329 High affinity nerve growth factor receptor; transf 99.92
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.92
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.91
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.89
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.85
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.84
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.83
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.82
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.81
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.8
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.8
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.8
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.78
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.78
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.77
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.77
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.76
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.76
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.76
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.75
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.75
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.75
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.74
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.74
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.74
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.74
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.74
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.74
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.74
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.74
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.73
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.73
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.73
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.73
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.73
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.73
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.73
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.72
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.72
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.72
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.72
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.72
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.72
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.72
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.72
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.72
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.71
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.71
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.71
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.71
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.71
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.7
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.7
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.7
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.7
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.7
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.7
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.7
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.7
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.7
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.7
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.7
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.69
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.69
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.69
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.69
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.69
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.69
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.69
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.69
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.68
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.68
3q4u_A301 Activin receptor type-1; structural genomics conso 99.68
3soc_A322 Activin receptor type-2A; structural genomics cons 99.67
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.67
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.67
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.66
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.66
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.66
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.66
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.66
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.66
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.66
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.66
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.66
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.66
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.65
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.65
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.65
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.65
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.65
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.65
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.65
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.65
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.65
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.64
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.64
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.63
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.63
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.63
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.63
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.63
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.63
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.63
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.63
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.63
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.63
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.63
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.62
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.62
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.62
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.62
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.62
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.62
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.62
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.61
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.61
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.61
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.61
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.61
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.61
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.61
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.61
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.61
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.61
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.61
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.61
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.6
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.6
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.6
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.6
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.6
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.6
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.6
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.6
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.6
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.6
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.6
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.59
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.59
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.59
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.59
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.59
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.59
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.59
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.59
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.59
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.59
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.59
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.59
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.59
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.59
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.59
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.58
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.58
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.58
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.58
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.58
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.58
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.58
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.58
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.58
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.58
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.58
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.58
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.58
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.58
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.58
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.58
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.57
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.57
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.57
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.57
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.57
3niz_A311 Rhodanese family protein; structural genomics, str 99.57
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.57
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.57
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.57
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.57
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.56
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.56
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.56
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.56
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.56
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.56
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.56
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.56
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.55
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.55
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.55
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.55
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.55
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.55
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.55
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.55
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.55
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.55
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.55
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.55
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.55
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.55
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.54
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.54
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.54
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.54
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.54
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.54
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.54
3bhy_A283 Death-associated protein kinase 3; death associate 99.54
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.54
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.54
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.54
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.54
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.53
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.53
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.53
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.53
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.53
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.53
3ork_A311 Serine/threonine protein kinase; structural genomi 99.53
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.53
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.52
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.52
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.52
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.51
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.51
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.51
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.51
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.51
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.5
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.5
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.5
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.5
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.5
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.49
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.49
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.49
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.49
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.48
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.48
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.47
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.46
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.45
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.43
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.31
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.31
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 98.98
3uqc_A286 Probable conserved transmembrane protein; structur 98.96
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.48
2ehb_D143 CBL-interacting serine/threonine-protein kinase 2; 90.36
2zfd_B123 Putative uncharacterized protein T20L15_90; calciu 89.06
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 88.95
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
Probab=99.92  E-value=6.1e-26  Score=187.21  Aligned_cols=102  Identities=26%  Similarity=0.406  Sum_probs=85.0

Q ss_pred             CeEEEeccccceEecCCee----EeecCC-cccCCCC------CCccchHHHHHHHHHH---hhccH------HHHHHHh
Q psy7025           1 MVGKHWLLGLLRYVLGKIL----CIATGA-SMVATGA------SMVGKHWLLGLLRYVL---GKILQ------STGASMV   60 (205)
Q Consensus         1 ~~aKl~DFGlar~~~~~~~----~~~~~~-~~~aPE~------~~ksDvwS~Gvvl~El---g~~p~------~~~~~i~   60 (205)
                      +.+||+||||||.+.....    ....|+ .|||||+      +.|+|||||||+||||   |+.|+      ++...+.
T Consensus       182 ~~~Ki~DFGlar~~~~~~~~~~~~~~~gt~~ymAPE~l~~~~~s~ksDVwSfGvvl~El~t~g~~Pf~~~~~~~~~~~i~  261 (308)
T 4gt4_A          182 LNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIR  261 (308)
T ss_dssp             GCEEECCSCCBCGGGGGGCBCSSSSSCBCGGGCCHHHHHHCCCCHHHHHHHHHHHHHHHHTTTCCTTTTCCHHHHHHHHH
T ss_pred             CCEEECCcccceeccCCCceeEecccccCCcccCHHHHhCCCCCccchhhhHHHHHHHHHhCCCCCCCCCCHHHHHHHHH
Confidence            3689999999997653321    122233 5899997      7789999999999999   67774      5677788


Q ss_pred             cCCCCCCCCCCcHHHHHHHHHHhccCCCCCCCHHHHHHHHHH
Q psy7025          61 GGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER  102 (205)
Q Consensus        61 ~~~~~~~p~~~~~~l~~li~~C~~~~p~~Rps~~ei~~~l~~  102 (205)
                      .+.+++.|..||.++++||.+||+.+|++||+|.+|++.|+.
T Consensus       262 ~~~~~~~p~~~~~~~~~li~~C~~~dP~~RPs~~ei~~~L~a  303 (308)
T 4gt4_A          262 NRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRA  303 (308)
T ss_dssp             TTCCCCCCTTCCHHHHHHHHHHTCSSGGGSCCHHHHHHHHHT
T ss_pred             cCCCCCCcccchHHHHHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            899999999999999999999999999999999999998863



>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2ehb_D CBL-interacting serine/threonine-protein kinase 2; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2zfd_B Putative uncharacterized protein T20L15_90; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 205
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-15
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-10
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-10
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 9e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-09
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-09
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-09
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-09
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 8e-09
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-09
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 9e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-08
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-08
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-08
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-08
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-08
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-08
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-08
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-07
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-06
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 6e-06
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 7e-06
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 7e-06
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-05
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-05
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-05
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-05
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 6e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-05
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 9e-05
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-04
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-04
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-04
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-04
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-04
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-04
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-04
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-04
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-04
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.002
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 0.002
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 0.004
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Insulin-like growth factor 1 receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.8 bits (175), Expect = 1e-15
 Identities = 29/55 (52%), Positives = 44/55 (80%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHS 116
           GG+L +PDNCPD LF LMR CWQ+ P+ RP+F+EI++ ++ ++   FR+VS+Y+S
Sbjct: 251 GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYS 305


>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.89
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.89
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.89
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.89
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.89
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.89
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.88
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.88
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.87
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.87
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.87
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.86
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.86
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.86
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.86
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.86
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.85
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.84
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.82
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.82
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.81
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.81
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.8
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.78
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.78
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.77
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.77
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.77
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.77
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.76
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.75
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.75
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.75
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.74
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.74
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.74
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.74
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.74
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.72
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.71
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.7
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.68
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.67
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.67
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.66
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.66
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.65
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.64
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.61
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.61
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.59
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.58
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.58
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.52
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.52
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.5
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.47
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.47
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.42
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.89  E-value=6.4e-24  Score=172.42  Aligned_cols=106  Identities=25%  Similarity=0.389  Sum_probs=79.2

Q ss_pred             CeEEEeccccceEecCCee----Ee---ecCC-cccCCCC------CCccchHHHHHHHHHH---hhccH------HHHH
Q psy7025           1 MVGKHWLLGLLRYVLGKIL----CI---ATGA-SMVATGA------SMVGKHWLLGLLRYVL---GKILQ------STGA   57 (205)
Q Consensus         1 ~~aKl~DFGlar~~~~~~~----~~---~~~~-~~~aPE~------~~ksDvwS~Gvvl~El---g~~p~------~~~~   57 (205)
                      +++||+|||+|+.+.....    ..   ..++ .|||||+      +.++|||||||+||||   |+.|+      ++..
T Consensus       165 ~~~Kl~DFGla~~~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~sDvwS~Gvvl~el~t~g~~Pf~~~~~~~~~~  244 (299)
T d1jpaa_         165 LVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVIN  244 (299)
T ss_dssp             CCEEECCC-----------------------CGGGSCHHHHHSCCCCHHHHHHHHHHHHHHHHTTSCCTTTTCCHHHHHH
T ss_pred             CcEEECCcccceEccCCCCcceeeecccccCCccccCHHHHhcCCCCcccccccchHHHHHHHhCCCCCCCCCCHHHHHH
Confidence            3689999999997754321    11   1122 4799987      5678999999999999   67774      5667


Q ss_pred             HHhcCCCCCCCCCCcHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHh
Q psy7025          58 SMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAA  106 (205)
Q Consensus        58 ~i~~~~~~~~p~~~~~~l~~li~~C~~~~p~~Rps~~ei~~~l~~~~~~  106 (205)
                      .+..+.+++.|..++.++.+|+.+||+.+|++||+|.+|++.|+++++.
T Consensus       245 ~i~~~~~~~~~~~~~~~l~~li~~cl~~~P~~RPs~~ei~~~L~~~l~~  293 (299)
T d1jpaa_         245 AIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRN  293 (299)
T ss_dssp             HHHTTCCCCCCTTCCHHHHHHHHHHTCSSTTTSCCHHHHHHHHHHHHHS
T ss_pred             HHHcCCCCCCCccchHHHHHHHHHHcCCCHhHCcCHHHHHHHHHHHhcC
Confidence            7888889999999999999999999999999999999999999988764



>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure