Diaphorina citri psyllid: psy7032

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MFGLRQIDKMRKDSIKLWLSYFDDSPTLPPPFNIFPTTKMFLKMFGLRQIDKMRKDSIKRKQQARQEKERDFRYAAVMRALVWRYICLQHRQADTNPVTEDDVNEVKGEITAMRYELMNVLEKNGMDTSSADKKEK
ccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccc
**GLRQIDKMRKDSIKLWLSYFDDSPTLPPPFNIFPTTKMFLKMFGLRQI********************DFRYAAVMRALVWRYICLQHRQADT*******VNEVKGEITAMRYELMNV****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGLRQIDKMRKDSIKLWLSYFDDSPTLPPPFNIFPTTKMFLKMFGLRQIDKMRKDSIKRKQQARQEKERDFRYAAVMRALVWRYICLQHRQADTNPVTEDDVNEVKGEITAMRYELMNVLEKNGMDTSSADKKEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005261 [MF]cation channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0070679 [MF]inositol 1,4,5 trisphosphate bindingprobableGO:0043168, GO:0043178, GO:0043167, GO:0036094, GO:0003674, GO:0005488
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted