Diaphorina citri psyllid: psy7033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
ccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccc
********VATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transient-receptor-potential-like protein A light-sensitive calcium channel that is required for inositide-mediated Ca(2+) entry in the retina during phospholipase C (PLC)-mediated phototransduction. Required for vision in the dark and in dim light. Binds calmodulin. Trp and trpl act together in the light response, although it is unclear whether as heteromultimers or distinct units. Also forms a functional cation channel with trp-gamma. Activated by fatty acids, metabolic stress, inositols and GTP-binding proteins.confidentP48994

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035997 [CC]rhabdomere microvillus membraneprobableGO:0031528, GO:0035996, GO:0016028, GO:0033583, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0005575, GO:0005902, GO:0071944, GO:0005886, GO:0044425, GO:0016020, GO:0042995, GO:0044459
GO:0034704 [CC]calcium channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0005575, GO:0034702, GO:0034703, GO:0044425, GO:0031224
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0051928 [BP]positive regulation of calcium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0051924, GO:0043270, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015279 [MF]store-operated calcium channel activityprobableGO:0022891, GO:0015085, GO:0022892, GO:0005261, GO:0005262, GO:0005215, GO:0005216, GO:0008324, GO:0015276, GO:0072509, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022890, GO:0022803, GO:0022839, GO:0022838, GO:0046873
GO:0008377 [BP]light-induced release of internally sequestered calcium ionprobableGO:0071482, GO:0009314, GO:0051282, GO:0051283, GO:0032844, GO:0009416, GO:0007165, GO:0007166, GO:0032879, GO:0050789, GO:0044699, GO:0051716, GO:0071478, GO:0065007, GO:0048519, GO:0071214, GO:0007186, GO:0009581, GO:0009582, GO:0009583, GO:0009584, GO:0009628, GO:0009987, GO:0007603, GO:0007602, GO:0008150, GO:0023052, GO:0007154, GO:0050794, GO:0044700, GO:0051606, GO:0009605, GO:0016056, GO:0050896, GO:2000021, GO:0044763
GO:0070588 [BP]calcium ion transmembrane transportprobableGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0070679 [MF]inositol 1,4,5 trisphosphate bindingprobableGO:0043168, GO:0043178, GO:0043167, GO:0036094, GO:0003674, GO:0005488
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted