Psyllid ID: psy7033
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 91080143 | 1213 | PREDICTED: similar to calmodulin-binding | 0.672 | 0.059 | 0.583 | 1e-21 | |
| 357607161 | 1019 | calmodulin-binding protein trpl [Danaus | 0.672 | 0.070 | 0.569 | 1e-21 | |
| 157110446 | 509 | transient receptor potential channel 4, | 0.672 | 0.141 | 0.583 | 5e-21 | |
| 170038655 | 1295 | calmodulin-binding protein trpl [Culex q | 0.672 | 0.055 | 0.597 | 8e-21 | |
| 158715 | 1124 | calmodulin-binding protein [Drosophila m | 0.672 | 0.064 | 0.555 | 4e-20 | |
| 17136770 | 1124 | trp-like, isoform A [Drosophila melanoga | 0.672 | 0.064 | 0.555 | 4e-20 | |
| 195332909 | 1124 | GM21150 [Drosophila sechellia] gi|194125 | 0.672 | 0.064 | 0.555 | 4e-20 | |
| 25009971 | 845 | GH05912p, partial [Drosophila melanogast | 0.672 | 0.085 | 0.555 | 5e-20 | |
| 195153601 | 1133 | GL17156 [Drosophila persimilis] gi|19411 | 0.672 | 0.063 | 0.541 | 6e-20 | |
| 194858342 | 1124 | GG24102 [Drosophila erecta] gi|190661024 | 0.672 | 0.064 | 0.555 | 6e-20 |
| >gi|91080143|ref|XP_968598.1| PREDICTED: similar to calmodulin-binding protein trpl [Tribolium castaneum] gi|270006411|gb|EFA02859.1| TRP gamma [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 107 bits (266), Expect = 1e-21, Method: Composition-based stats.
Identities = 42/72 (58%), Positives = 62/72 (86%)
Query: 36 QFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKI 95
+FVAH NIQQLLAA+WY+G+PGFRRK +K++ + K+ ++FP+YC+LYMI+ + TGK+
Sbjct: 297 KFVAHPNIQQLLAAIWYEGVPGFRRKSSTQKIMIIVKVAVLFPFYCMLYMITPGTKTGKL 356
Query: 96 IRKPFVKFVVHA 107
+RKPF+KF++HA
Sbjct: 357 MRKPFMKFLIHA 368
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357607161|gb|EHJ65372.1| calmodulin-binding protein trpl [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157110446|ref|XP_001651105.1| transient receptor potential channel 4, putative [Aedes aegypti] gi|108878709|gb|EAT42934.1| AAEL005586-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170038655|ref|XP_001847164.1| calmodulin-binding protein trpl [Culex quinquefasciatus] gi|167882363|gb|EDS45746.1| calmodulin-binding protein trpl [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158715|gb|AAA28979.1| calmodulin-binding protein [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|17136770|ref|NP_476895.1| trp-like, isoform A [Drosophila melanogaster] gi|24652173|ref|NP_724822.1| trp-like, isoform B [Drosophila melanogaster] gi|281363033|ref|NP_724823.2| trp-like, isoform D [Drosophila melanogaster] gi|25453459|sp|P48994.2|TRPL_DROME RecName: Full=Transient-receptor-potential-like protein gi|7303858|gb|AAF58904.1| trp-like, isoform A [Drosophila melanogaster] gi|21627600|gb|AAM68793.1| trp-like, isoform B [Drosophila melanogaster] gi|255982985|gb|ACU45760.1| HL01531p [Drosophila melanogaster] gi|272432415|gb|AAM68794.2| trp-like, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195332909|ref|XP_002033134.1| GM21150 [Drosophila sechellia] gi|194125104|gb|EDW47147.1| GM21150 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|25009971|gb|AAN71152.1| GH05912p, partial [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195153601|ref|XP_002017713.1| GL17156 [Drosophila persimilis] gi|194113509|gb|EDW35552.1| GL17156 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194858342|ref|XP_001969157.1| GG24102 [Drosophila erecta] gi|190661024|gb|EDV58216.1| GG24102 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| FB|FBgn0005614 | 1124 | trpl "trp-like" [Drosophila me | 0.831 | 0.079 | 0.473 | 4.4e-20 | |
| FB|FBgn0003861 | 1275 | trp "transient receptor potent | 0.663 | 0.055 | 0.563 | 8.2e-17 | |
| FB|FBgn0032593 | 1128 | trpgamma "trpgamma" [Drosophil | 0.672 | 0.063 | 0.5 | 3e-16 | |
| UNIPROTKB|F1M176 | 848 | Trpc5 "Protein Trpc5" [Rattus | 0.663 | 0.083 | 0.507 | 9.6e-14 | |
| UNIPROTKB|Q9UL62 | 973 | TRPC5 "Short transient recepto | 0.663 | 0.072 | 0.507 | 1.2e-13 | |
| UNIPROTKB|F1MTE6 | 974 | TRPC5 "Short transient recepto | 0.663 | 0.072 | 0.507 | 1.2e-13 | |
| UNIPROTKB|F1PA53 | 974 | TRPC5 "Uncharacterized protein | 0.663 | 0.072 | 0.507 | 1.2e-13 | |
| UNIPROTKB|F1RWU0 | 974 | TRPC5 "Uncharacterized protein | 0.663 | 0.072 | 0.507 | 1.2e-13 | |
| RGD|619787 | 974 | Trpc5 "transient receptor pote | 0.663 | 0.072 | 0.507 | 1.2e-13 | |
| UNIPROTKB|E9PSM8 | 974 | Trpc5 "Protein Trpc5" [Rattus | 0.663 | 0.072 | 0.507 | 1.2e-13 |
| FB|FBgn0005614 trpl "trp-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 251 (93.4 bits), Expect = 4.4e-20, P = 4.4e-20
Identities = 45/95 (47%), Positives = 73/95 (76%)
Query: 14 GDKL-ITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSK 72
GD++ +T Q+ Y+ +FVAHSNIQQLL+++WYDGLPGFRRK +++K++ +++
Sbjct: 292 GDRMSLTRLVQAISYKQK-----KFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQ 346
Query: 73 IILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA 107
+ ++FP YCL+YM + TG+++RKPF+KF++HA
Sbjct: 347 VAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHA 381
|
|
| FB|FBgn0003861 trp "transient receptor potential" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032593 trpgamma "trpgamma" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M176 Trpc5 "Protein Trpc5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UL62 TRPC5 "Short transient receptor potential channel 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MTE6 TRPC5 "Short transient receptor potential channel 5" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PA53 TRPC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWU0 TRPC5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|619787 Trpc5 "transient receptor potential cation channel, subfamily C, member 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSM8 Trpc5 "Protein Trpc5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| TIGR00870 | 743 | TIGR00870, trp, transient-receptor-potential calci | 3e-17 |
| >gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
Score = 75.1 bits (185), Expect = 3e-17
Identities = 29/71 (40%), Positives = 44/71 (61%)
Query: 37 FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKII 96
FVA N QQLL+ W + L G+RRK + +L+ + I L FP +Y+I+ +S G+
Sbjct: 286 FVAWPNGQQLLSLYWLEELDGWRRKQSVLELIVVFVIGLKFPELSDMYLIAPLSRLGQFK 345
Query: 97 RKPFVKFVVHA 107
KPF+KF+ H+
Sbjct: 346 WKPFIKFIFHS 356
|
The Transient Receptor Potential Ca2+ Channel (TRP-CC) Family (TC. 1.A.4)The TRP-CC family has also been called the store-operated calcium channel (SOC) family. The prototypical members include the Drosophila retinal proteinsTRP and TRPL (Montell and Rubin, 1989; Hardie and Minke, 1993). SOC members of the family mediate the entry of extracellular Ca2+ into cells in responseto depletion of intracellular Ca2+ stores (Clapham, 1996) and agonist stimulated production of inositol-1,4,5 trisphosphate (IP3). One member of the TRP-CCfamily, mammalian Htrp3, has been shown to form a tight complex with the IP3 receptor (TC #1.A.3.2.1). This interaction is apparently required for IP3 tostimulate Ca2+ release via Htrp3. The vanilloid receptor subtype 1 (VR1), which is the receptor for capsaicin (the ?hot? ingredient in chili peppers) and servesas a heat-activated ion channel in the pain pathway (Caterina et al., 1997), is also a member of this family. The stretch-inhibitable non-selective cation channel(SIC) is identical to the vanilloid receptor throughout all of its first 700 residues, but it exhibits a different sequence in its last 100 residues. VR1 and SICtransport monovalent cations as well as Ca2+. VR1 is about 10x more permeable to Ca2+ than to monovalent ions. Ca2+ overload probably causes cell deathafter chronic exposure to capsaicin. (McCleskey and Gold, 1999) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 743 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG3609|consensus | 822 | 99.95 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.37 | |
| KOG3614|consensus | 1381 | 99.18 |
| >KOG3609|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=7.5e-29 Score=211.59 Aligned_cols=83 Identities=41% Similarity=0.680 Sum_probs=80.5
Q ss_pred cCCCCcccccccccc--ceeehhHHHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhccc
Q psy7033 22 CQSHKYQPLPTNFFQ--FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKP 99 (107)
Q Consensus 22 ~~~~~~L~lAi~~~q--FVAHp~~Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s~~g~~~r~P 99 (107)
..+++|||+||+|+| |||||||||+|+++||+ |||+++...|++.+..++++||+++++|+++|+|+.|+++|+|
T Consensus 269 ~~sl~RLklAIkyeqK~FVahpNcQq~L~siWy~---g~R~~~~~~K~~~~~~~~~~~P~~~l~yllap~S~~G~~~r~P 345 (822)
T KOG3609|consen 269 RISLPRLKLAIKYEQKEFVAHPNCQQLLKSVWYS---GWRRKGIKPKFDAWRFLRLCFPMPSLVYLLAPMSRKGTTMRKP 345 (822)
T ss_pred ccccHHHHHHHHHhhhheecCccHHHHHHHHHhh---hhhhcchHHHHHHHHHHHHHhHHHHHHHHhCCCCcccchhhch
Confidence 367899999999999 99999999999999999 8999999999999999999999999999999999999999999
Q ss_pred eeeccccC
Q psy7033 100 FVKFVVHA 107 (107)
Q Consensus 100 fvKF~~h~ 107 (107)
|+||++|+
T Consensus 346 fmKFi~H~ 353 (822)
T KOG3609|consen 346 FMKFIAHI 353 (822)
T ss_pred HHHHHHHH
Confidence 99999995
|
|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG3614|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00