Psyllid ID: psy7033


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
ccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccc
cccccccccccccccHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccEEEEEEcc
MSESGLAQVATGIGdklithrcqshkyqplptnffQFVAHSNIQQLLAAMWydglpgfrrkpLLEKLLDLSKIILIFPYYCLLYMISgmsdtgkiirkpfvKFVVHA
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
********VATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVV**
*****LA*VATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
*********ATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
*************GDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
P48994 1124 Transient-receptor-potent yes N/A 0.672 0.064 0.555 1e-21
P19334 1275 Transient receptor potent no N/A 0.663 0.055 0.563 1e-18
Q9VJJ7 1128 Transient receptor potent no N/A 0.672 0.063 0.5 6e-18
Q9UL62 973 Short transient receptor yes N/A 0.672 0.073 0.5 1e-14
Q9QX29 975 Short transient receptor yes N/A 0.672 0.073 0.5 1e-14
O62852 974 Short transient receptor yes N/A 0.672 0.073 0.5 1e-14
Q9UBN4 977 Short transient receptor no N/A 0.672 0.073 0.458 2e-12
O35119 977 Short transient receptor no N/A 0.672 0.073 0.458 2e-12
Q9QUQ5 974 Short transient receptor no N/A 0.672 0.073 0.458 2e-12
P79100 979 Short transient receptor no N/A 0.672 0.073 0.444 2e-12
>sp|P48994|TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster GN=trpl PE=1 SV=2 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 63/72 (87%)

Query: 36  QFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKI 95
           +FVAHSNIQQLL+++WYDGLPGFRRK +++K++ ++++ ++FP YCL+YM +    TG++
Sbjct: 310 KFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQL 369

Query: 96  IRKPFVKFVVHA 107
           +RKPF+KF++HA
Sbjct: 370 MRKPFMKFLIHA 381




A light-sensitive calcium channel that is required for inositide-mediated Ca(2+) entry in the retina during phospholipase C (PLC)-mediated phototransduction. Required for vision in the dark and in dim light. Binds calmodulin. Trp and trpl act together in the light response, although it is unclear whether as heteromultimers or distinct units. Also forms a functional cation channel with trp-gamma. Activated by fatty acids, metabolic stress, inositols and GTP-binding proteins.
Drosophila melanogaster (taxid: 7227)
>sp|P19334|TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster GN=trp PE=1 SV=3 Back     alignment and function description
>sp|Q9VJJ7|TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster GN=trpgamma PE=1 SV=2 Back     alignment and function description
>sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 Back     alignment and function description
>sp|Q9QX29|TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus GN=Trpc5 PE=1 SV=2 Back     alignment and function description
>sp|O62852|TRPC5_RABIT Short transient receptor potential channel 5 OS=Oryctolagus cuniculus GN=TRPC5 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBN4|TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens GN=TRPC4 PE=1 SV=1 Back     alignment and function description
>sp|O35119|TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus GN=Trpc4 PE=1 SV=2 Back     alignment and function description
>sp|Q9QUQ5|TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus GN=Trpc4 PE=1 SV=1 Back     alignment and function description
>sp|P79100|TRPC4_BOVIN Short transient receptor potential channel 4 OS=Bos taurus GN=TRPC4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
91080143 1213 PREDICTED: similar to calmodulin-binding 0.672 0.059 0.583 1e-21
357607161 1019 calmodulin-binding protein trpl [Danaus 0.672 0.070 0.569 1e-21
157110446 509 transient receptor potential channel 4, 0.672 0.141 0.583 5e-21
170038655 1295 calmodulin-binding protein trpl [Culex q 0.672 0.055 0.597 8e-21
158715 1124 calmodulin-binding protein [Drosophila m 0.672 0.064 0.555 4e-20
17136770 1124 trp-like, isoform A [Drosophila melanoga 0.672 0.064 0.555 4e-20
195332909 1124 GM21150 [Drosophila sechellia] gi|194125 0.672 0.064 0.555 4e-20
25009971 845 GH05912p, partial [Drosophila melanogast 0.672 0.085 0.555 5e-20
195153601 1133 GL17156 [Drosophila persimilis] gi|19411 0.672 0.063 0.541 6e-20
194858342 1124 GG24102 [Drosophila erecta] gi|190661024 0.672 0.064 0.555 6e-20
>gi|91080143|ref|XP_968598.1| PREDICTED: similar to calmodulin-binding protein trpl [Tribolium castaneum] gi|270006411|gb|EFA02859.1| TRP gamma [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 62/72 (86%)

Query: 36  QFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKI 95
           +FVAH NIQQLLAA+WY+G+PGFRRK   +K++ + K+ ++FP+YC+LYMI+  + TGK+
Sbjct: 297 KFVAHPNIQQLLAAIWYEGVPGFRRKSSTQKIMIIVKVAVLFPFYCMLYMITPGTKTGKL 356

Query: 96  IRKPFVKFVVHA 107
           +RKPF+KF++HA
Sbjct: 357 MRKPFMKFLIHA 368




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357607161|gb|EHJ65372.1| calmodulin-binding protein trpl [Danaus plexippus] Back     alignment and taxonomy information
>gi|157110446|ref|XP_001651105.1| transient receptor potential channel 4, putative [Aedes aegypti] gi|108878709|gb|EAT42934.1| AAEL005586-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170038655|ref|XP_001847164.1| calmodulin-binding protein trpl [Culex quinquefasciatus] gi|167882363|gb|EDS45746.1| calmodulin-binding protein trpl [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158715|gb|AAA28979.1| calmodulin-binding protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17136770|ref|NP_476895.1| trp-like, isoform A [Drosophila melanogaster] gi|24652173|ref|NP_724822.1| trp-like, isoform B [Drosophila melanogaster] gi|281363033|ref|NP_724823.2| trp-like, isoform D [Drosophila melanogaster] gi|25453459|sp|P48994.2|TRPL_DROME RecName: Full=Transient-receptor-potential-like protein gi|7303858|gb|AAF58904.1| trp-like, isoform A [Drosophila melanogaster] gi|21627600|gb|AAM68793.1| trp-like, isoform B [Drosophila melanogaster] gi|255982985|gb|ACU45760.1| HL01531p [Drosophila melanogaster] gi|272432415|gb|AAM68794.2| trp-like, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195332909|ref|XP_002033134.1| GM21150 [Drosophila sechellia] gi|194125104|gb|EDW47147.1| GM21150 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|25009971|gb|AAN71152.1| GH05912p, partial [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195153601|ref|XP_002017713.1| GL17156 [Drosophila persimilis] gi|194113509|gb|EDW35552.1| GL17156 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|194858342|ref|XP_001969157.1| GG24102 [Drosophila erecta] gi|190661024|gb|EDV58216.1| GG24102 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0005614 1124 trpl "trp-like" [Drosophila me 0.831 0.079 0.473 4.4e-20
FB|FBgn0003861 1275 trp "transient receptor potent 0.663 0.055 0.563 8.2e-17
FB|FBgn0032593 1128 trpgamma "trpgamma" [Drosophil 0.672 0.063 0.5 3e-16
UNIPROTKB|F1M176 848 Trpc5 "Protein Trpc5" [Rattus 0.663 0.083 0.507 9.6e-14
UNIPROTKB|Q9UL62 973 TRPC5 "Short transient recepto 0.663 0.072 0.507 1.2e-13
UNIPROTKB|F1MTE6 974 TRPC5 "Short transient recepto 0.663 0.072 0.507 1.2e-13
UNIPROTKB|F1PA53 974 TRPC5 "Uncharacterized protein 0.663 0.072 0.507 1.2e-13
UNIPROTKB|F1RWU0 974 TRPC5 "Uncharacterized protein 0.663 0.072 0.507 1.2e-13
RGD|619787 974 Trpc5 "transient receptor pote 0.663 0.072 0.507 1.2e-13
UNIPROTKB|E9PSM8 974 Trpc5 "Protein Trpc5" [Rattus 0.663 0.072 0.507 1.2e-13
FB|FBgn0005614 trpl "trp-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 4.4e-20, P = 4.4e-20
 Identities = 45/95 (47%), Positives = 73/95 (76%)

Query:    14 GDKL-ITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSK 72
             GD++ +T   Q+  Y+       +FVAHSNIQQLL+++WYDGLPGFRRK +++K++ +++
Sbjct:   292 GDRMSLTRLVQAISYKQK-----KFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQ 346

Query:    73 IILIFPYYCLLYMISGMSDTGKIIRKPFVKFVVHA 107
             + ++FP YCL+YM +    TG+++RKPF+KF++HA
Sbjct:   347 VAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHA 381




GO:0005516 "calmodulin binding" evidence=ISS;NAS;IDA;TAS
GO:0005886 "plasma membrane" evidence=ISS;IDA;TAS
GO:0008086 "light-activated voltage-gated calcium channel activity" evidence=NAS;IMP
GO:0007603 "phototransduction, visible light" evidence=IMP
GO:0035997 "rhabdomere microvillus membrane" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0016028 "rhabdomere" evidence=IDA;NAS;TAS
GO:0009416 "response to light stimulus" evidence=TAS
GO:0019722 "calcium-mediated signaling" evidence=IMP;TAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0005262 "calcium channel activity" evidence=IGI;ISS;IDA
GO:0006816 "calcium ion transport" evidence=ISS;IDA
GO:0070588 "calcium ion transmembrane transport" evidence=IGI
GO:0071454 "cellular response to anoxia" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0016027 "inaD signaling complex" evidence=IPI
GO:0005261 "cation channel activity" evidence=TAS
GO:0015279 "store-operated calcium channel activity" evidence=NAS
GO:0016021 "integral to membrane" evidence=IEA
GO:0007589 "body fluid secretion" evidence=IMP
GO:0007605 "sensory perception of sound" evidence=IMP
FB|FBgn0003861 trp "transient receptor potential" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032593 trpgamma "trpgamma" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1M176 Trpc5 "Protein Trpc5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UL62 TRPC5 "Short transient receptor potential channel 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTE6 TRPC5 "Short transient receptor potential channel 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PA53 TRPC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWU0 TRPC5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|619787 Trpc5 "transient receptor potential cation channel, subfamily C, member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSM8 Trpc5 "Protein Trpc5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P48994TRPL_DROMENo assigned EC number0.55550.67280.0640yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 3e-17
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
 Score = 75.1 bits (185), Expect = 3e-17
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 37  FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKII 96
           FVA  N QQLL+  W + L G+RRK  + +L+ +  I L FP    +Y+I+ +S  G+  
Sbjct: 286 FVAWPNGQQLLSLYWLEELDGWRRKQSVLELIVVFVIGLKFPELSDMYLIAPLSRLGQFK 345

Query: 97  RKPFVKFVVHA 107
            KPF+KF+ H+
Sbjct: 346 WKPFIKFIFHS 356


The Transient Receptor Potential Ca2+ Channel (TRP-CC) Family (TC. 1.A.4)The TRP-CC family has also been called the store-operated calcium channel (SOC) family. The prototypical members include the Drosophila retinal proteinsTRP and TRPL (Montell and Rubin, 1989; Hardie and Minke, 1993). SOC members of the family mediate the entry of extracellular Ca2+ into cells in responseto depletion of intracellular Ca2+ stores (Clapham, 1996) and agonist stimulated production of inositol-1,4,5 trisphosphate (IP3). One member of the TRP-CCfamily, mammalian Htrp3, has been shown to form a tight complex with the IP3 receptor (TC #1.A.3.2.1). This interaction is apparently required for IP3 tostimulate Ca2+ release via Htrp3. The vanilloid receptor subtype 1 (VR1), which is the receptor for capsaicin (the ?hot? ingredient in chili peppers) and servesas a heat-activated ion channel in the pain pathway (Caterina et al., 1997), is also a member of this family. The stretch-inhibitable non-selective cation channel(SIC) is identical to the vanilloid receptor throughout all of its first 700 residues, but it exhibits a different sequence in its last 100 residues. VR1 and SICtransport monovalent cations as well as Ca2+. VR1 is about 10x more permeable to Ca2+ than to monovalent ions. Ca2+ overload probably causes cell deathafter chronic exposure to capsaicin. (McCleskey and Gold, 1999) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 743

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG3609|consensus 822 99.95
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.37
KOG3614|consensus 1381 99.18
>KOG3609|consensus Back     alignment and domain information
Probab=99.95  E-value=7.5e-29  Score=211.59  Aligned_cols=83  Identities=41%  Similarity=0.680  Sum_probs=80.5

Q ss_pred             cCCCCcccccccccc--ceeehhHHHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhccc
Q psy7033          22 CQSHKYQPLPTNFFQ--FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKP   99 (107)
Q Consensus        22 ~~~~~~L~lAi~~~q--FVAHp~~Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s~~g~~~r~P   99 (107)
                      ..+++|||+||+|+|  |||||||||+|+++||+   |||+++...|++.+..++++||+++++|+++|+|+.|+++|+|
T Consensus       269 ~~sl~RLklAIkyeqK~FVahpNcQq~L~siWy~---g~R~~~~~~K~~~~~~~~~~~P~~~l~yllap~S~~G~~~r~P  345 (822)
T KOG3609|consen  269 RISLPRLKLAIKYEQKEFVAHPNCQQLLKSVWYS---GWRRKGIKPKFDAWRFLRLCFPMPSLVYLLAPMSRKGTTMRKP  345 (822)
T ss_pred             ccccHHHHHHHHHhhhheecCccHHHHHHHHHhh---hhhhcchHHHHHHHHHHHHHhHHHHHHHHhCCCCcccchhhch
Confidence            367899999999999  99999999999999999   8999999999999999999999999999999999999999999


Q ss_pred             eeeccccC
Q psy7033         100 FVKFVVHA  107 (107)
Q Consensus       100 fvKF~~h~  107 (107)
                      |+||++|+
T Consensus       346 fmKFi~H~  353 (822)
T KOG3609|consen  346 FMKFIAHI  353 (822)
T ss_pred             HHHHHHHH
Confidence            99999995



>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG3614|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00