Diaphorina citri psyllid: psy7044


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MFDIFCPRSQVRSEGNVEIVNVPYNTKLSIVDILRKNSGVYRIKAENASGKDEADVEITVLILKENIN
ccCEEcccEEEcccccEEEEcccccCEEEEEcccccccCEEEEEEEcccccCEEEEEEEEEEEEcccc
*FDIFC*RSQVRSEGNVEIVNVPYNTKLSIVDILRKNSGVYRIKAENASGKDEADVEITVLILKEN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDIFCPRSQVRSEGNVEIVNVPYNTKLSIVDILRKNSGVYRIKAENASGKDEADVEITVLILKENIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B43, chain A
Confidence level:very confident
Coverage over the Query: 1-66
View the alignment between query and template
View the model in PyMOL