Diaphorina citri psyllid: psy7061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT
cccccccccEEEEcccccEEEEccccccEEEEEcccccEEEEccccccccEEEEEEcccccEEEc
MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LST8 homolog confidentQ29HG9
Protein LST8 homolog confidentQ9W328
WD repeat-containing protein wat1 May play a role in mRNA maturation as a coupling protein between splicing and synthesis and/or stabilization.confidentO74184

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0031932 [CC]TORC2 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031931 [CC]TORC1 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PM7, chain B
Confidence level:confident
Coverage over the Query: 1-65
View the alignment between query and template
View the model in PyMOL