Psyllid ID: psy7061
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| 225712316 | 365 | LTS8 homolog [Lepeophtheirus salmonis] | 1.0 | 0.178 | 0.615 | 1e-18 | |
| 91089925 | 315 | PREDICTED: similar to G protein beta sub | 0.969 | 0.2 | 0.650 | 5e-17 | |
| 270013561 | 309 | hypothetical protein TcasGA2_TC012179 [T | 0.969 | 0.203 | 0.650 | 5e-17 | |
| 242006179 | 320 | WD-repeat protein YNL006W, putative [Ped | 1.0 | 0.203 | 0.615 | 2e-16 | |
| 321478720 | 321 | hypothetical protein DAPPUDRAFT_205806 [ | 1.0 | 0.202 | 0.615 | 2e-16 | |
| 244790043 | 311 | MTOR associated protein, LST8 homolog [A | 1.0 | 0.209 | 0.646 | 6e-16 | |
| 291233680 | 325 | PREDICTED: LTS8 homolog [Saccoglossus ko | 1.0 | 0.2 | 0.6 | 4e-15 | |
| 405970246 | 317 | Target of rapamycin complex subunit lst8 | 0.969 | 0.198 | 0.587 | 5e-15 | |
| 72016103 | 315 | PREDICTED: target of rapamycin complex s | 1.0 | 0.206 | 0.553 | 6e-15 | |
| 380025568 | 320 | PREDICTED: target of rapamycin complex s | 1.0 | 0.203 | 0.584 | 1e-14 |
| >gi|225712316|gb|ACO12004.1| LTS8 homolog [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
Score = 97.1 bits (240), Expect = 1e-18, Method: Composition-based stats.
Identities = 40/65 (61%), Positives = 53/65 (81%)
Query: 1 MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDS 60
+ AH+ Y L C FSPD ++LATTSADQT+++WNT+D+SL +EL NQRWVWD AF+LDS
Sbjct: 261 IQAHKKYALRCKFSPDGKILATTSADQTSKLWNTDDYSLKKELKVDNQRWVWDLAFSLDS 320
Query: 61 KFLLT 65
++L T
Sbjct: 321 QYLFT 325
|
Source: Lepeophtheirus salmonis Species: Lepeophtheirus salmonis Genus: Lepeophtheirus Family: Caligidae Order: Siphonostomatoida Class: Maxillopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91089925|ref|XP_972979.1| PREDICTED: similar to G protein beta subunit-like [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270013561|gb|EFA10009.1| hypothetical protein TcasGA2_TC012179 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242006179|ref|XP_002423931.1| WD-repeat protein YNL006W, putative [Pediculus humanus corporis] gi|212507201|gb|EEB11193.1| WD-repeat protein YNL006W, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321478720|gb|EFX89677.1| hypothetical protein DAPPUDRAFT_205806 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|244790043|ref|NP_001156436.1| MTOR associated protein, LST8 homolog [Acyrthosiphon pisum] gi|239792846|dbj|BAH72716.1| ACYPI003573 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|291233680|ref|XP_002736782.1| PREDICTED: LTS8 homolog [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|405970246|gb|EKC35172.1| Target of rapamycin complex subunit lst8 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|72016103|ref|XP_786340.1| PREDICTED: target of rapamycin complex subunit lst8-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|380025568|ref|XP_003696542.1| PREDICTED: target of rapamycin complex subunit lst8-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 65 | ||||||
| FB|FBgn0264691 | 313 | Lst8 [Drosophila melanogaster | 0.953 | 0.198 | 0.619 | 2e-14 | |
| UNIPROTKB|Q29HG9 | 315 | GA15597 "Protein LST8 homolog" | 0.953 | 0.196 | 0.619 | 2.1e-14 | |
| DICTYBASE|DDB_G0292592 | 304 | lst8 "WD40 repeat-containing p | 0.953 | 0.203 | 0.555 | 1.5e-13 | |
| ZFIN|ZDB-GENE-030131-6176 | 326 | mlst8 "MTOR associated protein | 0.969 | 0.193 | 0.5 | 1.5e-13 | |
| UNIPROTKB|F1NAZ4 | 327 | MLST8 "Uncharacterized protein | 0.969 | 0.192 | 0.5 | 2.6e-13 | |
| POMBASE|SPBC21B10.05c | 314 | pop3 "WD repeat protein Pop3" | 0.953 | 0.197 | 0.553 | 6.3e-13 | |
| UNIPROTKB|Q17QU5 | 326 | MLST8 "Target of rapamycin com | 0.969 | 0.193 | 0.485 | 2e-12 | |
| UNIPROTKB|Q9BVC4 | 326 | MLST8 "Target of rapamycin com | 0.969 | 0.193 | 0.485 | 2e-12 | |
| UNIPROTKB|Q5I0B4 | 326 | mlst8 "Target of rapamycin com | 0.969 | 0.193 | 0.485 | 2e-12 | |
| UNIPROTKB|Q6PA72 | 326 | mlst8 "Target of rapamycin com | 0.969 | 0.193 | 0.485 | 2e-12 |
| FB|FBgn0264691 Lst8 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 187 (70.9 bits), Expect = 2.0e-14, P = 2.0e-14
Identities = 39/63 (61%), Positives = 42/63 (66%)
Query: 3 AHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKF 62
AH Y L C FSPD RLL TTS D T IW T+DFS REL N WVWDAAF+ DSK+
Sbjct: 212 AHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWRELCIENY-WVWDAAFSADSKW 270
Query: 63 LLT 65
L T
Sbjct: 271 LFT 273
|
|
| UNIPROTKB|Q29HG9 GA15597 "Protein LST8 homolog" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292592 lst8 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6176 mlst8 "MTOR associated protein, LST8 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAZ4 MLST8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC21B10.05c pop3 "WD repeat protein Pop3" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QU5 MLST8 "Target of rapamycin complex subunit LST8" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BVC4 MLST8 "Target of rapamycin complex subunit LST8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5I0B4 mlst8 "Target of rapamycin complex subunit lst8" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6PA72 mlst8 "Target of rapamycin complex subunit lst8" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 65 | |||
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 4e-10 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 3e-08 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 4e-08 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 3e-07 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 3e-07 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 5e-06 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 7e-06 | |
| pfam00400 | 39 | pfam00400, WD40, WD domain, G-beta repeat | 6e-05 | |
| smart00320 | 40 | smart00320, WD40, WD40 repeats | 1e-04 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 4e-04 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.001 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.002 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.002 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Score = 52.7 bits (127), Expect = 4e-10
Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
Query: 1 MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDS 60
+ H +Y FSPD R+L+++S D+T ++W+ E + L + WV AF+ D
Sbjct: 89 LTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDG 147
Query: 61 KFLLT 65
F+ +
Sbjct: 148 TFVAS 152
|
Length = 289 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197651 smart00320, WD40, WD40 repeats | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| KOG0271|consensus | 480 | 99.78 | ||
| KOG0272|consensus | 459 | 99.71 | ||
| KOG0263|consensus | 707 | 99.69 | ||
| KOG0266|consensus | 456 | 99.64 | ||
| KOG0272|consensus | 459 | 99.64 | ||
| KOG0263|consensus | 707 | 99.63 | ||
| KOG0271|consensus | 480 | 99.62 | ||
| KOG0286|consensus | 343 | 99.6 | ||
| KOG1539|consensus | 910 | 99.59 | ||
| KOG0286|consensus | 343 | 99.58 | ||
| KOG0284|consensus | 464 | 99.57 | ||
| KOG0279|consensus | 315 | 99.57 | ||
| PTZ00421 | 493 | coronin; Provisional | 99.54 | |
| KOG0318|consensus | 603 | 99.54 | ||
| KOG0266|consensus | 456 | 99.52 | ||
| KOG1407|consensus | 313 | 99.52 | ||
| KOG0291|consensus | 893 | 99.52 | ||
| KOG0315|consensus | 311 | 99.52 | ||
| KOG0273|consensus | 524 | 99.49 | ||
| KOG1034|consensus | 385 | 99.48 | ||
| KOG0279|consensus | 315 | 99.47 | ||
| KOG0296|consensus | 399 | 99.47 | ||
| KOG0645|consensus | 312 | 99.46 | ||
| KOG0645|consensus | 312 | 99.46 | ||
| PTZ00421 | 493 | coronin; Provisional | 99.46 | |
| KOG0273|consensus | 524 | 99.45 | ||
| KOG0283|consensus | 712 | 99.44 | ||
| KOG0293|consensus | 519 | 99.42 | ||
| KOG0295|consensus | 406 | 99.42 | ||
| KOG0265|consensus | 338 | 99.41 | ||
| KOG0285|consensus | 460 | 99.4 | ||
| KOG0319|consensus | 775 | 99.39 | ||
| PTZ00420 | 568 | coronin; Provisional | 99.39 | |
| KOG0650|consensus | 733 | 99.39 | ||
| KOG0973|consensus | 942 | 99.38 | ||
| KOG2394|consensus | 636 | 99.38 | ||
| KOG0318|consensus | 603 | 99.38 | ||
| KOG1445|consensus | 1012 | 99.37 | ||
| KOG0295|consensus | 406 | 99.37 | ||
| PTZ00420 | 568 | coronin; Provisional | 99.36 | |
| KOG0293|consensus | 519 | 99.36 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.35 | |
| KOG0289|consensus | 506 | 99.35 | ||
| KOG0315|consensus | 311 | 99.32 | ||
| KOG0291|consensus | 893 | 99.31 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 99.31 | |
| KOG0288|consensus | 459 | 99.31 | ||
| KOG1273|consensus | 405 | 99.29 | ||
| KOG0283|consensus | 712 | 99.29 | ||
| KOG0284|consensus | 464 | 99.29 | ||
| KOG0264|consensus | 422 | 99.29 | ||
| KOG0319|consensus | 775 | 99.29 | ||
| KOG0275|consensus | 508 | 99.28 | ||
| KOG2110|consensus | 391 | 99.27 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 99.26 | |
| KOG0643|consensus | 327 | 99.25 | ||
| KOG0640|consensus | 430 | 99.24 | ||
| KOG4283|consensus | 397 | 99.24 | ||
| KOG0278|consensus | 334 | 99.24 | ||
| KOG0285|consensus | 460 | 99.24 | ||
| KOG0305|consensus | 484 | 99.23 | ||
| KOG2394|consensus | 636 | 99.23 | ||
| KOG1273|consensus | 405 | 99.22 | ||
| KOG0292|consensus | 1202 | 99.22 | ||
| KOG0282|consensus | 503 | 99.2 | ||
| KOG0294|consensus | 362 | 99.19 | ||
| KOG2111|consensus | 346 | 99.19 | ||
| KOG0641|consensus | 350 | 99.19 | ||
| KOG0310|consensus | 487 | 99.19 | ||
| KOG0289|consensus | 506 | 99.18 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.18 | |
| KOG0973|consensus | 942 | 99.17 | ||
| KOG0316|consensus | 307 | 99.16 | ||
| KOG0296|consensus | 399 | 99.16 | ||
| KOG0643|consensus | 327 | 99.16 | ||
| KOG0269|consensus | 839 | 99.15 | ||
| KOG0292|consensus | 1202 | 99.15 | ||
| KOG0313|consensus | 423 | 99.15 | ||
| KOG0276|consensus | 794 | 99.15 | ||
| KOG0316|consensus | 307 | 99.15 | ||
| KOG1063|consensus | 764 | 99.14 | ||
| KOG0265|consensus | 338 | 99.14 | ||
| KOG0306|consensus | 888 | 99.13 | ||
| KOG1063|consensus | 764 | 99.12 | ||
| KOG0278|consensus | 334 | 99.12 | ||
| KOG0302|consensus | 440 | 99.12 | ||
| KOG0308|consensus | 735 | 99.11 | ||
| KOG0277|consensus | 311 | 99.11 | ||
| KOG0772|consensus | 641 | 99.1 | ||
| KOG0322|consensus | 323 | 99.09 | ||
| KOG1009|consensus | 434 | 99.09 | ||
| KOG1274|consensus | 933 | 99.08 | ||
| KOG1446|consensus | 311 | 99.08 | ||
| KOG0306|consensus | 888 | 99.07 | ||
| KOG1446|consensus | 311 | 99.07 | ||
| KOG2096|consensus | 420 | 99.07 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.06 | |
| KOG1310|consensus | 758 | 99.06 | ||
| KOG0303|consensus | 472 | 99.06 | ||
| KOG0268|consensus | 433 | 99.05 | ||
| KOG1408|consensus | 1080 | 99.03 | ||
| KOG0299|consensus | 479 | 99.03 | ||
| KOG0275|consensus | 508 | 99.02 | ||
| KOG2096|consensus | 420 | 99.02 | ||
| KOG0303|consensus | 472 | 99.01 | ||
| KOG0300|consensus | 481 | 99.01 | ||
| KOG1407|consensus | 313 | 99.0 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.0 | |
| KOG0282|consensus | 503 | 99.0 | ||
| KOG1007|consensus | 370 | 99.0 | ||
| KOG1009|consensus | 434 | 99.0 | ||
| KOG0640|consensus | 430 | 98.99 | ||
| KOG0264|consensus | 422 | 98.99 | ||
| KOG0974|consensus | 967 | 98.99 | ||
| KOG0302|consensus | 440 | 98.98 | ||
| KOG0281|consensus | 499 | 98.97 | ||
| KOG1538|consensus | 1081 | 98.97 | ||
| KOG0269|consensus | 839 | 98.97 | ||
| KOG0267|consensus | 825 | 98.96 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.95 | |
| KOG0267|consensus | 825 | 98.95 | ||
| KOG0281|consensus | 499 | 98.94 | ||
| KOG0772|consensus | 641 | 98.94 | ||
| KOG0276|consensus | 794 | 98.93 | ||
| KOG0646|consensus | 476 | 98.92 | ||
| KOG0313|consensus | 423 | 98.9 | ||
| KOG0647|consensus | 347 | 98.9 | ||
| KOG1524|consensus | 737 | 98.89 | ||
| KOG0646|consensus | 476 | 98.89 | ||
| KOG0771|consensus | 398 | 98.88 | ||
| KOG0270|consensus | 463 | 98.88 | ||
| KOG0308|consensus | 735 | 98.88 | ||
| KOG0647|consensus | 347 | 98.88 | ||
| KOG0300|consensus | 481 | 98.86 | ||
| KOG0294|consensus | 362 | 98.86 | ||
| KOG1036|consensus | 323 | 98.82 | ||
| KOG4227|consensus | 609 | 98.82 | ||
| KOG1538|consensus | 1081 | 98.8 | ||
| KOG2106|consensus | 626 | 98.79 | ||
| KOG0305|consensus | 484 | 98.78 | ||
| KOG1523|consensus | 361 | 98.77 | ||
| KOG1332|consensus | 299 | 98.74 | ||
| KOG0639|consensus | 705 | 98.73 | ||
| KOG0277|consensus | 311 | 98.73 | ||
| KOG0290|consensus | 364 | 98.69 | ||
| KOG0274|consensus | 537 | 98.68 | ||
| KOG1524|consensus | 737 | 98.67 | ||
| KOG0771|consensus | 398 | 98.66 | ||
| KOG0268|consensus | 433 | 98.66 | ||
| KOG0310|consensus | 487 | 98.65 | ||
| KOG0307|consensus | 1049 | 98.65 | ||
| KOG2139|consensus | 445 | 98.65 | ||
| KOG2110|consensus | 391 | 98.65 | ||
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 98.61 | |
| KOG2055|consensus | 514 | 98.61 | ||
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 98.61 | |
| KOG0301|consensus | 745 | 98.6 | ||
| KOG0274|consensus | 537 | 98.6 | ||
| KOG1539|consensus | 910 | 98.58 | ||
| KOG1408|consensus | 1080 | 98.56 | ||
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 98.56 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.55 | |
| KOG0639|consensus | 705 | 98.54 | ||
| KOG2445|consensus | 361 | 98.54 | ||
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 98.52 | |
| KOG1272|consensus | 545 | 98.52 | ||
| KOG4328|consensus | 498 | 98.52 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 98.51 | |
| KOG1034|consensus | 385 | 98.51 | ||
| KOG1963|consensus | 792 | 98.5 | ||
| KOG0321|consensus | 720 | 98.5 | ||
| KOG1332|consensus | 299 | 98.49 | ||
| KOG2139|consensus | 445 | 98.48 | ||
| KOG2445|consensus | 361 | 98.48 | ||
| KOG0649|consensus | 325 | 98.47 | ||
| KOG1445|consensus | 1012 | 98.47 | ||
| KOG2919|consensus | 406 | 98.46 | ||
| KOG0299|consensus | 479 | 98.46 | ||
| KOG0288|consensus | 459 | 98.45 | ||
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 98.44 | |
| KOG1274|consensus | 933 | 98.43 | ||
| KOG0644|consensus | 1113 | 98.42 | ||
| KOG1963|consensus | 792 | 98.41 | ||
| KOG2055|consensus | 514 | 98.4 | ||
| KOG0644|consensus | 1113 | 98.4 | ||
| KOG2919|consensus | 406 | 98.39 | ||
| KOG0641|consensus | 350 | 98.38 | ||
| KOG0642|consensus | 577 | 98.38 | ||
| KOG0290|consensus | 364 | 98.38 | ||
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 98.38 | |
| KOG4378|consensus | 673 | 98.37 | ||
| KOG1188|consensus | 376 | 98.35 | ||
| KOG4283|consensus | 397 | 98.34 | ||
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 98.34 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 98.33 | |
| KOG0307|consensus | 1049 | 98.33 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.32 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 98.31 | |
| KOG4497|consensus | 447 | 98.27 | ||
| KOG4547|consensus | 541 | 98.26 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.26 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 98.25 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.25 | |
| KOG1272|consensus | 545 | 98.21 | ||
| KOG0301|consensus | 745 | 98.21 | ||
| KOG0642|consensus | 577 | 98.19 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 98.19 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 98.18 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 98.17 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 98.14 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 98.13 | |
| KOG0270|consensus | 463 | 98.12 | ||
| KOG4328|consensus | 498 | 98.1 | ||
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 98.1 | |
| KOG1523|consensus | 361 | 98.08 | ||
| KOG4378|consensus | 673 | 98.08 | ||
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 98.07 | |
| KOG2048|consensus | 691 | 98.07 | ||
| KOG1007|consensus | 370 | 98.05 | ||
| KOG0649|consensus | 325 | 98.01 | ||
| KOG1036|consensus | 323 | 97.99 | ||
| KOG4497|consensus | 447 | 97.98 | ||
| KOG0322|consensus | 323 | 97.98 | ||
| KOG2041|consensus | 1189 | 97.97 | ||
| KOG1409|consensus | 404 | 97.93 | ||
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.93 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 97.88 | |
| KOG2315|consensus | 566 | 97.86 | ||
| KOG3914|consensus | 390 | 97.85 | ||
| KOG2106|consensus | 626 | 97.84 | ||
| KOG3881|consensus | 412 | 97.8 | ||
| KOG4640|consensus | 665 | 97.78 | ||
| KOG2048|consensus | 691 | 97.78 | ||
| KOG0280|consensus | 339 | 97.78 | ||
| KOG4547|consensus | 541 | 97.73 | ||
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 97.72 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.7 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 97.69 | |
| KOG0650|consensus | 733 | 97.63 | ||
| KOG1334|consensus | 559 | 97.62 | ||
| KOG4640|consensus | 665 | 97.61 | ||
| KOG1334|consensus | 559 | 97.6 | ||
| KOG3881|consensus | 412 | 97.6 | ||
| KOG2321|consensus | 703 | 97.59 | ||
| KOG1240|consensus | 1431 | 97.58 | ||
| KOG2079|consensus | 1206 | 97.55 | ||
| KOG3914|consensus | 390 | 97.55 | ||
| KOG1188|consensus | 376 | 97.54 | ||
| KOG1587|consensus | 555 | 97.52 | ||
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.52 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 97.49 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 97.48 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 97.48 | |
| KOG4227|consensus | 609 | 97.46 | ||
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 97.43 | |
| KOG4532|consensus | 344 | 97.39 | ||
| KOG1587|consensus | 555 | 97.36 | ||
| KOG2111|consensus | 346 | 97.36 | ||
| KOG2314|consensus | 698 | 97.35 | ||
| KOG4190|consensus | 1034 | 97.34 | ||
| KOG0280|consensus | 339 | 97.29 | ||
| KOG4714|consensus | 319 | 97.28 | ||
| KOG3621|consensus | 726 | 97.27 | ||
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 97.25 | |
| KOG1832|consensus | 1516 | 97.23 | ||
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 97.22 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 97.21 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 97.17 | |
| KOG1310|consensus | 758 | 97.17 | ||
| KOG1240|consensus | 1431 | 97.17 | ||
| KOG4714|consensus | 319 | 97.16 | ||
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 97.14 | |
| KOG2066|consensus | 846 | 97.13 | ||
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.1 | |
| KOG0321|consensus | 720 | 97.04 | ||
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 97.01 | |
| KOG2321|consensus | 703 | 96.96 | ||
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 96.88 | |
| KOG1517|consensus | 1387 | 96.87 | ||
| KOG2314|consensus | 698 | 96.85 | ||
| KOG1645|consensus | 463 | 96.85 | ||
| KOG1354|consensus | 433 | 96.83 | ||
| KOG3617|consensus | 1416 | 96.77 | ||
| KOG2315|consensus | 566 | 96.73 | ||
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 96.73 | |
| KOG1064|consensus | 2439 | 96.7 | ||
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 96.68 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.48 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 96.46 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 96.41 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 96.4 | |
| KOG2695|consensus | 425 | 96.36 | ||
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.29 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 96.26 | |
| PF14761 | 215 | HPS3_N: Hermansky-Pudlak syndrome 3 | 96.23 | |
| KOG1409|consensus | 404 | 96.21 | ||
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 96.19 | |
| KOG0974|consensus | 967 | 96.1 | ||
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 96.07 | |
| KOG1920|consensus | 1265 | 95.94 | ||
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 95.74 | |
| KOG3617|consensus | 1416 | 95.72 | ||
| PF07676 | 39 | PD40: WD40-like Beta Propeller Repeat; InterPro: I | 95.69 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 95.64 | |
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 95.61 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 95.6 | |
| KOG2395|consensus | 644 | 95.52 | ||
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 95.47 | |
| KOG2041|consensus | 1189 | 95.45 | ||
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 95.39 | |
| KOG4499|consensus | 310 | 95.22 | ||
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 95.21 | |
| KOG3621|consensus | 726 | 95.19 | ||
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 95.18 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 95.0 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 94.83 | |
| KOG1912|consensus | 1062 | 94.78 | ||
| PF02897 | 414 | Peptidase_S9_N: Prolyl oligopeptidase, N-terminal | 94.68 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 94.68 | |
| COG3490 | 366 | Uncharacterized protein conserved in bacteria [Fun | 94.22 | |
| KOG3630|consensus | 1405 | 94.01 | ||
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 93.48 | |
| PF14583 | 386 | Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C | 93.13 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 93.11 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 92.7 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 92.69 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 92.68 | |
| KOG0309|consensus | 1081 | 92.63 | ||
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 92.56 | |
| KOG1275|consensus | 1118 | 92.5 | ||
| KOG0309|consensus | 1081 | 92.5 | ||
| COG5167 | 776 | VID27 Protein involved in vacuole import and degra | 92.45 | |
| TIGR02171 | 912 | Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou | 92.42 | |
| KOG1354|consensus | 433 | 92.2 | ||
| KOG1920|consensus | 1265 | 91.92 | ||
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 91.83 | |
| PF14870 | 302 | PSII_BNR: Photosynthesis system II assembly factor | 91.82 | |
| KOG1517|consensus | 1387 | 91.39 | ||
| KOG2377|consensus | 657 | 91.23 | ||
| PRK10115 | 686 | protease 2; Provisional | 91.17 | |
| KOG0882|consensus | 558 | 91.14 | ||
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 91.08 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 90.54 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 90.46 | |
| TIGR02171 | 912 | Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou | 90.41 | |
| KOG1064|consensus | 2439 | 90.37 | ||
| KOG0882|consensus | 558 | 88.84 | ||
| KOG4532|consensus | 344 | 88.78 | ||
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 88.65 | |
| PF05787 | 524 | DUF839: Bacterial protein of unknown function (DUF | 88.54 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 88.45 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 88.15 | |
| KOG2695|consensus | 425 | 87.97 | ||
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 87.63 | |
| PF10584 | 23 | Proteasome_A_N: Proteasome subunit A N-terminal si | 87.08 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 86.8 | |
| KOG1645|consensus | 463 | 86.51 | ||
| KOG2066|consensus | 846 | 85.8 | ||
| COG3211 | 616 | PhoX Predicted phosphatase [General function predi | 85.67 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 85.01 | |
| KOG4649|consensus | 354 | 84.26 | ||
| PF12234 | 631 | Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 | 83.29 | |
| TIGR02276 | 42 | beta_rpt_yvtn 40-residue YVTN family beta-propelle | 83.23 | |
| PF12566 | 122 | DUF3748: Protein of unknown function (DUF3748); In | 82.3 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 82.11 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 81.9 |
| >KOG0271|consensus | Back alignment and domain information |
|---|
Probab=99.78 E-value=3.1e-18 Score=80.12 Aligned_cols=64 Identities=28% Similarity=0.421 Sum_probs=60.7
Q ss_pred CCccccceEEEEECCCCCEEEEecCCCcEEEEECCCCceEEEeeccCCCcEeEEEEccCCcEEeC
Q psy7061 1 MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT 65 (65)
Q Consensus 1 l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~i~s 65 (65)
+.+|.+.|.++.|+|++..+++++.|..+++||+.+.....+..+ |...|.+++|+||++.|+|
T Consensus 111 ~~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~Kg-H~~WVlcvawsPDgk~iAS 174 (480)
T KOG0271|consen 111 IAGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKG-HKNWVLCVAWSPDGKKIAS 174 (480)
T ss_pred cCCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecC-CccEEEEEEECCCcchhhc
Confidence 468999999999999999999999999999999999999999999 9999999999999999875
|
|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0974|consensus | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG4227|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG2139|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1272|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG2139|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4497|consensus | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1272|consensus | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG4497|consensus | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG2041|consensus | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >KOG3914|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >KOG4640|consensus | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >KOG4640|consensus | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG2079|consensus | Back alignment and domain information |
|---|
| >KOG3914|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4227|consensus | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4532|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG2314|consensus | Back alignment and domain information |
|---|
| >KOG4190|consensus | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG4714|consensus | Back alignment and domain information |
|---|
| >KOG3621|consensus | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG4714|consensus | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2066|consensus | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1517|consensus | Back alignment and domain information |
|---|
| >KOG2314|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG1354|consensus | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >KOG1064|consensus | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2695|consensus | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >KOG0974|consensus | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1920|consensus | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >KOG2395|consensus | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG2041|consensus | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3621|consensus | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1912|consensus | Back alignment and domain information |
|---|
| >PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >COG3490 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3630|consensus | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >KOG1275|consensus | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 | Back alignment and domain information |
|---|
| >KOG1354|consensus | Back alignment and domain information |
|---|
| >KOG1920|consensus | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A | Back alignment and domain information |
|---|
| >KOG1517|consensus | Back alignment and domain information |
|---|
| >KOG2377|consensus | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 | Back alignment and domain information |
|---|
| >KOG1064|consensus | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >KOG4532|consensus | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2695|consensus | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3 | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG2066|consensus | Back alignment and domain information |
|---|
| >COG3211 PhoX Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG4649|consensus | Back alignment and domain information |
|---|
| >PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length | Back alignment and domain information |
|---|
| >TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat | Back alignment and domain information |
|---|
| >PF12566 DUF3748: Protein of unknown function (DUF3748); InterPro: IPR022223 This domain family is found in bacteria and eukaryotes, and is approximately 120 amino acids in length | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 65 | ||||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 9e-04 |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.78 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.75 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.71 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.7 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.69 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.68 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.68 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.66 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.66 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.66 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.66 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.65 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.65 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.65 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.64 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.63 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.63 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.62 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.62 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.61 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.61 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.61 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.6 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.6 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.6 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.59 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.59 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.59 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.58 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.58 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.58 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.57 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.57 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.56 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.56 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.56 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.56 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.56 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.55 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.55 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.54 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.54 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.53 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.53 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.53 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.53 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.53 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.52 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.52 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.52 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.51 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.51 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.5 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.5 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.48 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.48 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.48 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.48 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.47 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.47 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.47 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.46 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.46 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.45 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.45 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.45 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.45 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.44 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.44 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.44 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.44 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.43 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.43 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.43 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.43 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.43 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.42 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.42 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.41 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.41 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.41 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.41 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.41 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.4 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.4 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.4 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.4 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.38 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.38 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.38 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.37 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.37 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.37 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.37 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.36 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.36 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.35 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.35 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.34 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.34 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.34 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.34 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.34 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.33 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.32 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.32 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.3 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.29 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.28 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.28 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.27 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.27 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.26 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.26 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.26 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.23 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.21 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.19 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 99.17 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.15 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 99.13 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.1 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.1 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.1 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 99.09 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.02 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.02 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.01 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.93 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.93 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.93 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 98.93 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.91 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.88 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.87 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 98.84 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.83 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.8 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 98.77 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.76 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.73 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.72 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.7 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.69 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.68 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 98.67 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.66 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.65 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.62 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.62 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.62 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 98.6 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 98.58 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.58 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 98.57 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.53 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.53 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 98.5 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.5 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 98.5 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.5 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 98.49 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.46 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.46 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.42 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 98.4 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 98.38 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.38 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.37 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.32 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 98.31 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.28 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 98.25 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.24 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.23 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.22 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.18 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.15 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 98.12 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 98.12 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.07 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 98.04 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 98.0 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 98.0 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.94 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.89 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 97.86 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.85 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.83 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 97.8 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.71 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 97.7 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 97.69 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.65 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.56 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.54 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 97.5 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.47 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 97.43 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.34 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 97.3 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 97.28 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.22 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.2 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.19 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 97.17 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 97.15 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 97.14 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 97.1 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 97.05 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.86 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 96.86 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 96.74 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 96.62 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 96.37 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 96.37 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 96.28 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 96.26 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 96.23 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.22 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.2 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 95.86 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 95.64 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 95.63 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 95.6 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 95.59 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 95.53 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 95.4 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 95.09 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 95.04 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 95.02 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 94.87 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 94.72 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 94.72 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 94.14 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 94.02 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 93.37 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 93.31 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 93.2 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 92.41 | |
| 1flg_A | 582 | Protein (quinoprotein ethanol dehydrogenase); supe | 91.63 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 91.28 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 90.67 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 89.26 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 89.09 | |
| 1w6s_A | 599 | Methanol dehydrogenase subunit 1; anisotropic, ele | 87.66 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 87.26 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 87.18 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 86.95 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 86.81 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 86.12 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 86.04 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 85.76 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 84.84 | |
| 3f7f_A | 729 | Nucleoporin NUP120; nuclear pore complex, macromol | 83.91 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 83.86 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 82.82 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 80.13 |
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
Probab=99.78 E-value=4e-18 Score=79.04 Aligned_cols=63 Identities=13% Similarity=0.090 Sum_probs=56.9
Q ss_pred ccccceEEEEECCCCCEEEEecCCCcEEEEECCCCceEEEeeccCCCcEeEEEEccCCcEEeC
Q psy7061 3 AHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT 65 (65)
Q Consensus 3 ~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~i~s 65 (65)
+|...|.+++|+|+++++++++.|+.+++|++.+++.+..+...|...|.+++|+|++++|+|
T Consensus 267 ~~~~~V~~~~~Spdg~~lasgs~D~~V~iwd~~~~~~~~~~~~gH~~~V~~v~fSpdg~~laS 329 (365)
T 4h5i_A 267 NRFKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVAS 329 (365)
T ss_dssp SSCSCEEEEEECTTSCEEEEEETTSCEEEEETTTTEEEEEETTSSSSCEEEEEECTTSCEEEE
T ss_pred CCCCCeEeEEECCCCCceEEEcCCCEEEEEECCCCcEEEEecCcccCCEEEEEECCCCCEEEE
Confidence 567789999999999999999999999999999999888764338999999999999999975
|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 65 | ||||
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 8e-09 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 4e-04 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 4e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 5e-08 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 7e-06 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 8e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-07 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 1e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 0.002 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 1e-06 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 5e-05 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 1e-06 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 0.002 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 2e-06 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 2e-06 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 7e-06 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 0.003 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 7e-06 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 0.002 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 8e-06 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.001 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.002 | |
| d1jmxb_ | 346 | b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase | 4e-05 | |
| d1jmxb_ | 346 | b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase | 2e-04 | |
| d1pbyb_ | 337 | b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase | 1e-04 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 3e-04 | |
| d1qksa2 | 432 | b.70.2.1 (A:136-567) C-terminal (heme d1) domain o | 3e-04 | |
| d2bbkh_ | 355 | b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { | 0.001 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 0.004 |
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Groucho/tle1, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.5 bits (111), Expect = 8e-09
Identities = 11/62 (17%), Positives = 25/62 (40%), Gaps = 2/62 (3%)
Query: 4 HRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFL 63
H + L F+ + +T D W T + + + ++ V ++D K++
Sbjct: 264 HESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESS--SVLSCDISVDDKYI 321
Query: 64 LT 65
+T
Sbjct: 322 VT 323
|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 65 | |||
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.78 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.75 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.74 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.66 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.65 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.62 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.61 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.59 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.59 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.56 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.56 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.55 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.55 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.53 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.52 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.51 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.47 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.46 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.43 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.41 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.36 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.36 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.34 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.32 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.29 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.27 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.15 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.13 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.1 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.08 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 99.02 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.96 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.94 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.94 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.76 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 98.69 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.68 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.64 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.53 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.48 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.47 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.46 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.4 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.36 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.34 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.34 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.33 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 98.08 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 98.07 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.94 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 97.77 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.72 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 97.64 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.62 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.49 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 97.47 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.35 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.3 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 97.28 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 97.11 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.53 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 96.16 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.03 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 96.01 | |
| d1qfma1 | 430 | Prolyl oligopeptidase, N-terminal domain {Pig (Sus | 95.88 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 95.65 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 95.42 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 94.96 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 94.42 | |
| d1w6sa_ | 596 | Methanol dehydrogenase, heavy chain {Methylobacter | 91.32 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 90.94 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 90.74 | |
| d1flga_ | 582 | Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax | 90.61 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 90.15 | |
| d2ad6a1 | 571 | Methanol dehydrogenase, heavy chain {Methylophilus | 89.5 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 89.44 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 88.8 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 86.46 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.78 E-value=2.6e-18 Score=76.62 Aligned_cols=64 Identities=22% Similarity=0.389 Sum_probs=59.5
Q ss_pred CCccccceEEEEECCCCCEEEEecCCCcEEEEECCCCceEEEeeccCCCcEeEEEEccCCcEEeC
Q psy7061 1 MAAHRAYGLHCVFSPDCRLLATTSADQTARIWNTEDFSLVRELGTANQRWVWDAAFTLDSKFLLT 65 (65)
Q Consensus 1 l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~i~s 65 (65)
|+||.+.|.+++|+|+++++++++.|+.+++|++.+++.+..+.. |...|.+++|+|++.++++
T Consensus 51 L~GH~~~I~~l~~s~~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~-~~~~v~~v~~~~~~~~l~~ 114 (340)
T d1tbga_ 51 LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPL-RSSWVMTCAYAPSGNYVAC 114 (340)
T ss_dssp ECCCSSCEEEEEECTTSSEEEEEETTTEEEEEETTTTEEEEEEEC-SCSCEEEEEECTTSSEEEE
T ss_pred ECCCCCCEEEEEECCCCCEEEEEECCCceeeeecccceeEEEEec-ccccEEeeEeeccceeeee
Confidence 568999999999999999999999999999999999999888888 8999999999999998763
|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|