Diaphorina citri psyllid: psy7075


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MKTILCRQVFEKPLKESKILTREEHGQIFVNWKEIIVCNHMFLRALRVRRDMSSKGDIRMIGDILCEHLPRMTAYVRFCSCQLSAAALLQKLTDQSPEFKTISKKCRWISRIFLLETETISPLLKLISPLLKEIV
ccHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccHHHHHHHcc
MKTILCRQVFEKPLKESKILTREEHGQIFVNWKEIIVCNHMFLRALRVRRDMSSKGDIRMIGDILCEHLPRMTAYVRFCSCQLSAAALLQKLTDQSPEFKTISKKCRWISRIFLLETETISPLLKLISPLLKEIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTILCRQVFEKPLKESKILTREEHGQIFVNWKEIIVCNHMFLRALRVRRDMSSKGDIRMIGDILCEHLPRMTAYVRFCSCQLSAAALLQKLTDQSPEFKTISKKCRWISRIFLLETETISPLLKLISPLLKEIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Intersectin-1 Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Inhibits ARHGAP31 activity toward RAC1.confidentQ9Z0R4
Intersectin-1 Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling. Inhibits ARHGAP31 activity toward RAC1.confidentQ15811

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051897 [BP]positive regulation of protein kinase B signaling cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0050789, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0051896, GO:0048522
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0042327 [BP]positive regulation of phosphorylationprobableGO:0042325, GO:0019220, GO:0009893, GO:0045937, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0031325, GO:0048522
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005905 [CC]coated pitprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0032947 [MF]protein complex scaffoldprobableGO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0019209 [MF]kinase activator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0008047

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JV3, chain A
Confidence level:very confident
Coverage over the Query: 2-135
View the alignment between query and template
View the model in PyMOL