Diaphorina citri psyllid: psy7088


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870---
MRNVCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYHISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKDSLQQCCDLSQLWYREFYLEMTMGRRIQKCVVRHQHNEECSDLITMEKRIQFPIEMSMPWILTDHILKTKEPSMMEYVLYPLDLYNDSAHYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAASMLLDKRFRVECMAMGTYLLAYPRANRYETLLRQRHVQLLGRSIDLNKLITQRINADMHKSLDLAISKFEHGDITGVVELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNGATNRITLHIFWELNYDFLPNYCYNGATNRFIKCRGIMFTQQIHREKLPPMTHTYSWGSKQLNMAYYSIYGQYTGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYYHAQLNDIVQYPDAKTELFHNFRELGNTILFCLLMEQALSQEEVCDLLHAAPFQNILPRPYCKEGEKPETKQKRLEQKYASLQIVSNIDRLGTAKQAMIAREGDLLTRERLCCGLSIFEVVLNRLRGFLDDPIWVGPPPTNGVINIDECTEFHRLWSALQFVYCIPVGDTEFTVEELFGEGLNWAGCTMIVLLGQQRRFEALDFCYHILRVQRVDGRDENVKGIHLKRMVDRIRRFQVVNSQIFATLNKYLGSSDADAASVEHVRCFPPPIHPSLAQQHGHYYRPENMMNNNMH
ccccccccccEEEcccccccccEEcHHHHHHHcccHHHHHHHHHHHHccccEEEcccccccHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHccccEEEcccHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHccEEEEEcccccccHHHHHHHHHcccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccHHccccccHHHHEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHccc
MRNVCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYHISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKDSLQQCCDLSQLWYREFYLEMTMGRRIQKCVVRHQHNEECSDLITMEKRIQFPIEMSMPWILTDHILKTKEPSMMEYVLYPLDLYNDSAHYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAASMLLDKRFRVECMAMGTYLLAYPRANRYETLLRQRHVQLLGRSIDLNKLITQRINADMHKSLDLAISKFEHGDITGVVELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNGATNRITLHIFWELNYDFLPNYCYNGATNRFIKCRGIMFTQQIHREKLPPMTHTYSWGSKQLNMAYYSIYGQYTGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYYHAQLNDIVQYPDAKTELFHNFRELGNTILFCLLMEQALSQEEVCDLLHAAPFQNILPRPYC***************KYASLQIVSNIDRLGTAKQAMIAREGDLLTRERLCCGLSIFEVVLNRLRGFLDDPIWVGPPPTNGVINIDECTEFHRLWSALQFVYCIPVGDTEFTVEELFGEGLNWAGCTMIVLLGQQRRFEALDFCYHILRVQRVDGRDENVKGIHLKRMVDRIRRFQVVNSQIFATLNKYLGSSDADAASVEHVRCFPPPI***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNVCDRDSGLTVLGTRYRCPVGIAPSAMQKLAHADGEVATARAAGMMDAIMILSLMSTTSLEEVRAQNPSTTLWLQMYIFKDRALSLQMVQRAERSGYSAIVITMDTAVLGSRYHISKFRDISAEECSSGLTDYVANQFDDSVDWDDVRSLVQATKLPIVCKDSLQQCCDLSQLWYREFYLEMTMGRRIQKCVVRHQHNEECSDLITMEKRIQFPIEMSMPWILTDHILKTKEPSMMEYVLYPLDLYNDSAHYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAASMLLDKRFRVECMAMGTYLLAYPRANRYETLLRQRHVQLLGRSIDLNKLITQRINADMHKSLDLAISKFEHGDITGVVELEGLLAVNRLCHKLLSKLLGLDDYDAMLHEANHNVLAPYGRITLHIFWELNYDFLPNYCYNGATNRITLHIFWELNYDFLPNYCYNGATNRFIKCRGIMFTQQIHREKLPPMTHTYSWGSKQLNMAYYSIYGQYTGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYYHAQLNDIVQYPDAKTELFHNFRELGNTILFCLLMEQALSQEEVCDLLHAAPFQNILPRPYCKEGEKPETKQKRLEQKYASLQIVSNIDRLGTAKQAMIAREGDLLTRERLCCGLSIFEVVLNRLRGFLDDPIWVGPPPTNGVINIDECTEFHRLWSALQFVYCIPVGDTEFTVEELFGEGLNWAGCTMIVLLGQQRRFEALDFCYHILRVQRVDGRDENVKGIHLKRMVDRIRRFQVVNSQIFATLNKYLGSSDADAASVEHVRCFPPPIHPSLAQQHGHYYRPENMMNNNMH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic FMR1-interacting protein Plays a role in guidance and morphology of central and peripheral axons and in synaptic morphology. Also required for formation of cell membrane protrusions and for bristle development.confidentQ299G2
Cytoplasmic FMR1-interacting protein Plays a role in guidance and morphology of central and peripheral axons and in synaptic morphology. Also required for formation of cell membrane protrusions and for bristle development.confidentQ9VF87
Cytoplasmic FMR1-interacting protein 2 Involved in T-cell adhesion and p53-dependent induction of apoptosis (By similarity). Does not bind RNA.confidentQ5SQX6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0031209 [CC]SCAR complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0030032 [BP]lamellipodium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0045202 [CC]synapseprobableGO:0005575
GO:0097202 [BP]activation of cysteine-type endopeptidase activityprobableGO:0051336, GO:0019222, GO:0051345, GO:0052547, GO:2000116, GO:0050790, GO:2001056, GO:0008150, GO:0052548, GO:0065007, GO:0044093, GO:0010950, GO:0065009, GO:0010952, GO:0050789, GO:0043085
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0001745 [BP]compound eye morphogenesisprobableGO:0048749, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0030866 [BP]cortical actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0050807 [BP]regulation of synapse organizationprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050803, GO:0050877, GO:0009987, GO:0044763, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0050789, GO:0044699, GO:0003008
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0045862 [BP]positive regulation of proteolysisprobableGO:0009893, GO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051246, GO:0051247, GO:0050794, GO:0008150, GO:0065007, GO:0030162, GO:0048518, GO:0032270, GO:0010604, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-122,138-167
View the alignment between query and template
View the model in PyMOL
Template: 3P8C, chain A
Confidence level:confident
Coverage over the Query: 341-365,376-427
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3p8c, chain Avery confident Alignment | Template Structure