Diaphorina citri psyllid: psy7091


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MVYATESKHKKNGEIVCHRARDLQYGRRPSLPVRVVPAFSLQTHQKNTITGAPPKCVPKDKTYDYTSMFRTYYSRGDFPIAMEFKSVGNKISWKEDIKTLNYQYYLPIFFDGLRETEYPYKFFASKGIHDLLENGKDKIVPVLPHLILPIKNALSTRNPEVICETLKVLQHLVTSSSMVGEALVPYYKQILPHLNMYKDLNNRYR
cccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEEcccccEEEEccccccccccccHHHHHccccccccccHHHHHHHHHHHHHcccccCECccHHcHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccc
****************C*R*R******************************APPKCVPKDKTYDYTSMFRTYYSRGDFPIAMEFKSVGNKISWKEDIKTLNYQYYLPIFFDGLRETEYPYKFFASKGIHDLLENGKDKIVPVLPHLILPIKNALSTRNPEVICETLKVLQHLVTSSSMVGEALVPYYKQILPHLNMYKDL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYATESKHKKNGEIVCHRARDLQYGRRPSLPVRVVPAFSLQTHQKNTITGAPPKCVPKDKTYDYTSMFRTYYSRGDFPIAMEFKSVGNKISWKEDIKTLNYQYYLPIFFDGLRETEYPYKFFASKGIHDLLENGKDKIVPVLPHLILPIKNALSTRNPEVICETLKVLQHLVTSSSMVGEALVPYYKQILPHLNMYKDLNNRYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Parkin coregulated gene protein homolog Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited.confidentQ9DAK2
Parkin coregulated gene protein Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited. May play an important role in the formation of Lewy bodies and protection of dopaminergic neurons against Parkinson disease.confidentQ96M98

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097225 [CC]sperm midpieceprobableGO:0005575, GO:0044463, GO:0043231, GO:0031514, GO:0036126, GO:0044441, GO:0044464, GO:0097223, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QK2, chain A
Confidence level:probable
Coverage over the Query: 106-203
View the alignment between query and template
View the model in PyMOL