Diaphorina citri psyllid: psy7099


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MVKFLGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYR
cccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
**KFLGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKFLGFVGAYHFRAMCRLLGYQGIAVVMEELLKIVTSLIQGSLLQFTKTLMDAMPKQCKLPRYDYGSPGVLGYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic FMR1-interacting protein Plays a role in guidance and morphology of central and peripheral axons and in synaptic morphology. Also required for formation of cell membrane protrusions and for bristle development.confidentQ299G2
Cytoplasmic FMR1-interacting protein Plays a role in guidance and morphology of central and peripheral axons and in synaptic morphology. Also required for formation of cell membrane protrusions and for bristle development.confidentQ9VF87
Cytoplasmic FMR1-interacting protein 1 Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA (By similarity). Regulates formation of membrane ruffles and lamellipodia. Plays a role in axon outgrowth. Binds to F-actin but not to RNA. Part of the WAVE complex that regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. Regulator of epithelial morphogenesis. May act as an invasion suppressor in cancers.confidentQ7L576

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0031209 [CC]SCAR complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001745 [BP]compound eye morphogenesisprobableGO:0048749, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0030866 [BP]cortical actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0050807 [BP]regulation of synapse organizationprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050803, GO:0050877, GO:0009987, GO:0044763, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0050789, GO:0044699, GO:0003008
GO:0045202 [CC]synapseprobableGO:0005575
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0030032 [BP]lamellipodium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045862 [BP]positive regulation of proteolysisprobableGO:0009893, GO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051246, GO:0051247, GO:0050794, GO:0008150, GO:0065007, GO:0030162, GO:0048518, GO:0032270, GO:0010604, GO:0050789, GO:0048522
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0097202 [BP]activation of cysteine-type endopeptidase activityprobableGO:0051336, GO:0019222, GO:0051345, GO:0052547, GO:2000116, GO:0050790, GO:2001056, GO:0008150, GO:0052548, GO:0065007, GO:0044093, GO:0010950, GO:0065009, GO:0010952, GO:0050789, GO:0043085
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8C, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL