Diaphorina citri psyllid: psy70


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MPESSKPHQWQSDEASVRAGTCYFHVKVPFVIQYEVMFQDKHDCGGAYLKLLTEGPALQDLTAFNDKTPYTIMFGPDKCGTDDKVCTV
cccccccccccccccccccccccccccccEEEEEEEEEcccCCccccEEEEEcccccccccccccccccEEEEEccccccccccEEEc
****************VRAGTCYFHVKVPFVIQYEVMFQDKHDCGGAYLKLLTEGPALQDLTAFNDKTPYTIMFGPDKCGTDDKVCTV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPESSKPHQWQSDEASVRAGTCYFHVKVPFVIQYEVMFQDKHDCGGAYLKLLTEGPALQDLTAFNDKTPYTIMFGPDKCGTDDKVCTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calnexin homolog Interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.confidentQ6Q487
Calnexin Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.confidentP24643
Calnexin Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.confidentP27824

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0034185 [MF]apolipoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0009505 [CC]plant-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0071840 [BP]cellular component organization or biogenesisprobableGO:0008150
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0097038 [CC]perinuclear endoplasmic reticulumprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0048471, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0035255 [MF]ionotropic glutamate receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0035254
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007338 [BP]single fertilizationprobableGO:0044702, GO:0000003, GO:0009566, GO:0019953, GO:0022414, GO:0008150, GO:0044699
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005791 [CC]rough endoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0034975 [BP]protein folding in endoplasmic reticulumprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHN, chain A
Confidence level:very confident
Coverage over the Query: 13-88
View the alignment between query and template
View the model in PyMOL